KEGG   Corynebacterium diphtheriae BH8: CDBH8_2354Help
Entry
CDBH8_2354        CDS       T01698                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDBH8_2354 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDBH8_2354 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDBH8_2354 (trpB2)
Enzymes [BR:cdb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDBH8_2354 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2462021..2463247
Genome map
AA seq 408 aa AA seqDB search
MKHTLLPAYFGEFGGQYVPESLIPALDQLEAAFVEAQNDPEFRAELAGYLKDYLGRPTPL
TLCSKLPKAGKGKGHARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKTRIIAETGAGQH
GTATALACALLDLDCVIYMGAKDVERQQPNVYRMELMGAKVVPVDSGSGTLKDAVNEALR
DWTATFHESHYLLGTAAGPHPFPTIVREFHRVISEEAKAQILEQTGALPDVVVACVGGGS
NAIGMFADFIDDPSVELVGAEPGGMGLSSGKHGATINNGQIGILHGARSYLMRNSDGQVE
ESYSISAGLDYPGVGPQHAHLAKSGRARYVAITDAEALEAFQLLSREEGIIPALESSHAL
AYALKRAALAEENNEDITIVVSLSGRGDKDIDHIRRTLSAHPELVVKD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacacactgctaccggcatacttcggagaattcggcggacaatacgtacccgaa
tcccttatccccgccctcgaccaattagaagcggccttcgtggaagcgcaaaacgatccc
gagtttagagccgaactcgccggctacctcaaggactacctcggtcgtcccacgccactc
acgctctgctccaagctacccaaagccggaaaagggaaggggcacgcgcggatcttcctc
aaacgagaagacctcgttcacggcggcgcacacaaaaccaaccaagtaatcggccaagcc
cttttagctaaacgcatgggtaaaacccgcattattgctgaaaccggtgctggacaacac
ggaaccgccaccgcactcgcatgcgcactgctcgacctcgactgcgtgatctacatgggc
gctaaagacgtggaacgccaacaacccaacgtgtaccgcatggagctcatgggcgccaag
gtcgtaccagtcgactccggctccggaaccctcaaagatgcagtcaacgaagcactgcgc
gattggaccgcaaccttccacgagtcacactatctgctcggcaccgcagccgggccacac
ccatttcccacgattgtgcgcgaattccaccgcgtaatctcagaagaagccaaagcccaa
atacttgagcaaaccggcgcactgccagatgtggtggtcgcctgcgtcggcggcggatcc
aacgctatcggcatgttcgccgactttatcgacgatccctcagtagaactcgtcggcgcg
gaaccaggcggaatgggactaagctccggaaaacacggcgctaccatcaacaacggccaa
atcggtattttgcatggcgccagaagctacctcatgcgcaactccgatggccaagtagag
gaatcctattctatttcagccggcctcgactacccaggtgtcggcccacaacacgcccat
ctagcaaagtctgggcgcgcccgctatgtcgccatcactgatgcggaagcactcgaagca
ttccaattgctctcccgcgaagagggcatcatcccggccttggaatccagccacgctctt
gcttatgcactcaaacgtgccgccctcgctgaggaaaacaacgaagatatcaccatcgtg
gtgtccttgtctggccgtggcgacaaggacatcgaccacatccgccgcactctttccgcc
cacccagagctggttgtaaaggactaa

DBGET integrated database retrieval system