KEGG   Corynebacterium diphtheriae BH8: CDBH8_2355Help
Entry
CDBH8_2355        CDS       T01698                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
cdb00260  Glycine, serine and threonine metabolism
cdb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdb01100  Metabolic pathways
cdb01110  Biosynthesis of secondary metabolites
cdb01130  Biosynthesis of antibiotics
cdb01230  Biosynthesis of amino acids
Module
cdb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDBH8_2355 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDBH8_2355 (trpA)
Enzymes [BR:cdb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDBH8_2355 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA IMPDH His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEX49868
Position
2463252..2464088
Genome map
AA seq 278 aa AA seqDB search
MTRYTKLFSALSAKNEGAFVPFIMLGAPTPEASLAIIRTVVAAGADALELGVPFSDPVAD
GPTIQRSHLRALDNGATVDSSLELIRQIRKEFPELPIGMLIYGNVAFTRGITQFYQEFAD
AGVDSILLPDVPVREGEPFIAAAKQPGIDPIFIAPAQASEATLEEVAQHSSGYIYAISRD
GVTGTERQSSTRGLEQVVANVKRFGGAPILLGFGISTPEHVRDAIAAGASGAITGSALTS
IIERHTTGTHPEPAQVTDLEALTEEIFAFVKDMKAATR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactcgctacaccaaattattctccgcactcagcgccaaaaacgaaggtgcattcgtc
cccttcatcatgctgggtgctcccaccccagaggcgtcgttagcaatcatccgtaccgtc
gttgccgcgggtgccgacgccctcgaactcggcgtccccttctccgacccagtagcagac
ggccccacaatccaacgctcccacctccgtgccctcgacaacggagccaccgtcgatagc
tcgctggaactgatccgacagatccgcaaagaattccccgaacttcccatcggcatgctc
atctacggcaacgttgccttcacccgcgggatcacccagttctatcaagaattcgccgac
gccggcgtagactccatcctgcttcccgacgtccctgtccgcgaaggcgagcctttcatc
gcagctgccaagcaacctgggatcgaccccatcttcatcgcccccgcacaagcctcggaa
gcaaccttggaagaggtagcgcaacactccagcggatacatctacgccatctcccgcgat
ggtgtgaccggaaccgaacgccaatcctctactaggggactagagcaagtggtagcaaat
gtgaaacgcttcggcggtgcaccgatcctgctcggtttcggcatctccacacccgagcat
gtgcgcgacgcaatcgcggcaggagccagcggcgccattacaggctccgcactgacgtcg
atcatcgagcggcacaccacaggcacgcacccagagccagcccaagtgacagaccttgag
gctctgaccgaagaaattttcgcgttcgttaaagatatgaaagccgcaacccgttaa

DBGET integrated database retrieval system