KEGG   Clostridium difficile CD196: CD196_0018Help
Entry
CD196_0018        CDS       T00997                                 

Gene name
recD
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
cdc  Clostridium difficile CD196
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CD196_0018 (recD)
DNA repair and recombination proteins [BR:cdc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CD196_0018 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22387..22986
Genome map
AA seq 199 aa AA seqDB search
MQVYTGPITRLIEEFSKLPGVGRKTAQRLAFHIINMNTNDVEALSKAIIDAKREIRYCSI
CCNITDTDPCSMCSNKSRDSSVICVVEDPRDVAAMERTREFKGQYHVLNGVISPMDGIGP
DMLKIKELIQRLGNQEVKEIIMATNPTIEGEATAMYIARLVKPMGIKVTRIAHGLPVGGD
LEYADEVTISKALEGRREI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtttatacaggtcccataacgagacttatagaggaattttcaaagcttcctgga
gtaggaagaaagactgctcaaagattggcttttcatattattaatatgaatactaatgat
gtggaagctttatctaaagcgattatagatgcaaaaagagaaataagatattgctcaatt
tgttgtaatataacagatacagacccatgtagcatgtgttcaaataaaagtagagattca
agtgttatatgtgttgtggaagatccaagagatgtagcagctatggagagaacgagagag
tttaaaggacagtatcatgtattaaatggagtaatttctccaatggatggaattggacca
gatatgttaaaaataaaggaacttatccaaagacttggcaatcaggaagtcaaagaaata
ataatggcaacaaatcctactattgaaggtgaagcgacagccatgtatattgctaggtta
gtaaaaccaatgggaatcaaagtcactcggatagctcatggtcttcctgttggaggcgat
ttagagtatgcagatgaggtcacaatatcaaaagcactagaaggcagaagagaaatataa

DBGET integrated database retrieval system