KEGG   Clostridioides difficile CD196: CD196_0039Help
Entry
CD196_0039        CDS       T00997                                 

Gene name
acoC
Definition
(GenBank) E2 component of acetoin dehydrogenase enzyme system (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00010  Glycolysis / Gluconeogenesis
cdc00020  Citrate cycle (TCA cycle)
cdc00620  Pyruvate metabolism
cdc01100  Metabolic pathways
cdc01110  Biosynthesis of secondary metabolites
cdc01120  Microbial metabolism in diverse environments
cdc01130  Biosynthesis of antibiotics
cdc01200  Carbon metabolism
Module
cdc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD196_0039 (acoC)
   00020 Citrate cycle (TCA cycle)
    CD196_0039 (acoC)
   00620 Pyruvate metabolism
    CD196_0039 (acoC)
Enzymes [BR:cdc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CD196_0039 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding AATase CAT
Motif
Other DBs
NCBI-ProteinID: CBA60111
UniProt: A0A0H3N7A8
Position
60333..61379
Genome map
AA seq 348 aa AA seqDB search
MVANKIKATPAARSQARKDNIKLDRLIGSGENGRIHLVDVLNYLKDNKANTTPLARRIAE
DLNIDLETIVGTGYSGKIRKCDVEKLTAKETIVSNNTSKYSEKKELKIENENSSMFNTVE
GIFEKPNPMRATVAKRMSESYFSAPVFTFNIEVDATELKVLRAKLIDTVKESTGVKLTMT
DLIVMAVSKILPNHQALNSAWTDEGIFRYKDVNIAIAVGLDEGLYVPVVKNANKKSLKEI
AKESKELAEKVKTGKLMPADQEGNTFTISNVGMYGITTFTPIINMPSSAILGVGATQDKF
VPVNGEAKIKPIMNLSLTSDHRVIDGTVAAKFLKDLKELLENPLSMLV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtggcaaataaaataaaagccacaccagcagctagaagtcaggcaagaaaagacaat
ataaaattagataggctgattggaagtggagaaaatggaaggattcatttagtagatgtg
ttaaattatttaaaagataataaagcaaatactactcctttagctagaagaatagcagaa
gatttaaatatagatttagaaactattgtaggtactggatatagtggaaagataagaaag
tgtgatgtggaaaaattaactgcaaaagaaactattgtatcaaataatacatctaaatat
agtgagaaaaaagagctgaaaattgaaaatgaaaattcaagcatgtttaacacagtagaa
ggaatatttgaaaagccaaatccaatgagagctactgtagcaaaacgaatgtcagaaagt
tattttagtgctcctgtatttacattcaatatagaagtagatgctacagaattgaaggta
cttagagcaaagttaatcgacacagtaaaagaatcaactggagtaaaattaactatgaca
gatttaatagtaatggcagtatctaaaatacttccaaatcatcaagccttaaattcagca
tggacagatgagggtatatttagatataaagatgtaaatatagctattgcagttggttta
gatgaaggcttatatgttccggtagtaaaaaatgcaaacaaaaagtctttaaaagaaata
gcaaaagaaagcaaagaacttgcggaaaaagtaaagacagggaaacttatgccagcagac
caagaaggtaatacatttacaataagtaatgttggaatgtatggtataactacatttaca
cctataataaatatgccttcaagtgcaatcttaggggtaggtgctacacaagataagttt
gttccagtaaatggagaggctaaaataaaacctataatgaacttatcattaacatcagac
catagagtaatagatggaacagtagctgcaaaattcttaaaagatttaaaagaattgtta
gaaaatcctttatcaatgcttgtatag

DBGET integrated database retrieval system