KEGG   Clostridium difficile CD196: CD196_0052Help
Entry
CD196_0052        CDS       T00997                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
cdc  Clostridium difficile CD196
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:cdc00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
76919..78400
Genome map
AA seq 493 aa AA seqDB search
MNVRVRFAPSPTGFVHIGSLRTALYNYLFAKKMGGEYILRVEDTDQSRLVEGAIENMLNA
MKWAGVNHSEGVILDDSGKVVQKGEYGPYIQSQRLDIYQEYIKQLLDSGKAYYCFCTKER
LDEVRDAQRAAGETAKYDGHCKNLSKEEVEANIKAGIPYVIRLRLPENHTIKFTDLVRGD
MEFNTNDLDDQVLMKTDGFPTYHFAVVVDDYLMKITHVIRGEEWVSSTPKHVYLYEAFGW
EAPVFVHLPNILNKEKKKLSKRQGDVAVEDFKKKGYLPEGLVNYVALVGWSPEDNQELFT
MEELEKAFSVERVSKSGGVFDTEKLNWVNQHYIKDGDDAYLTDLAIPFLVEDGFITEEEA
TNKYDFLKSMISVLKEKLQYVKEITEHASIFFGDKIEVETEEGREFLRLEHIPTLIDALR
EKIEKTEVLNAEFVQAMLKEIQKEYKIKGKNLFMGSRIILTGQMHGPDLPKVMEVLGKET
CLNRIAYVKNNIL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaagagtaaggtttgcaccaagtccaacaggatttgtacatataggtagtttg
agaactgctttatataactatttatttgcaaaaaaaatgggtggagaatatatattaaga
gtggaagatacagaccaaagtagattagtagaaggtgctatagagaatatgcttaatgct
atgaaatgggctggtgtcaaccatagtgaaggtgttatattagatgatagtggaaaagta
gtacaaaaaggagaatatggtccatatattcaatctcaaagattagatatataccaagaa
tatataaagcaacttttagatagtggaaaagcttattattgtttctgtacaaaagaaaga
ctggatgaagtaagagatgctcaaagagcagcaggagaaacagctaaatatgatggtcat
tgtaagaatctttctaaagaagaagtagaagcgaatataaaagcaggaataccatatgtt
ataagattaagattgccagagaatcatacaattaagtttacagacttagttagaggagat
atggaatttaatactaatgacctagatgaccaagtattaatgaaaacagatggatttcca
acttatcattttgcagtagttgttgatgactatttgatgaaaattacacatgttataaga
ggagaagaatgggtatcatctactccaaaacatgtttatttatatgaagcttttggatgg
gaagcacctgtatttgtgcatttaccaaatatacttaataaagaaaagaaaaaattaagt
aaaagacaaggtgatgtagctgttgaagactttaagaaaaaaggatatttaccagaggga
ttagtaaactatgtagcattagttggttggtctcctgaagataatcaagaattgtttaca
atggaggaattagaaaaagccttctctgtagaaagagtatctaaaagtggtggagtattt
gatactgaaaaattaaattgggttaatcagcactatataaaagatggtgatgatgcttat
ctaacagacttagcaataccatttttagtagaagatggatttataacagaagaagaagct
actaataaatatgatttcttaaagagtatgatatcagtacttaaagagaaattacaatat
gtaaaagaaattactgaacatgcaagtatattttttggagataaaatagaggtagaaact
gaagagggaagagagttcttaagattagaacatatacctactttaatagatgctttgaga
gaaaaaatagaaaaaacagaggtattaaatgctgagtttgttcaagctatgcttaaagaa
atacaaaaagagtacaaaataaaagggaaaaatttatttatgggctcaagaataattttg
acagggcaaatgcatggtccagatttaccaaaagtaatggaagttttaggaaaagaaact
tgcttaaatagaatagcttatgtaaaaaataatatattatag

DBGET integrated database retrieval system