KEGG   Clostridium difficile CD196: CD196_0056Help
Entry
CD196_0056        CDS       T00997                                 

Definition
dihydrofolate reductase region
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cdc  Clostridium difficile CD196
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cdc00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cdc00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
82067..82561
Genome map
AA seq 164 aa AA seqDB search
MKVIVAVDLNWGIGYGGKLLQSIPEDMKFFKEKTVGNVVVMGRETFKSLPGKKALKDRVN
IVLTRSKSFNDDRLIVCNSIDETLKELQKYENDKIFIIGGETVYKQFLPYCNELYVTKIQ
KTYEADRFFPNIDIMSNWDLIKESEVKEYNNIRYVFSTYINNSL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttatagtagctgtagatttaaattggggaattggttatggtggaaagttacta
cagtcgattcctgaagatatgaaattttttaaagaaaaaactgtaggtaatgtagttgta
atggggagagaaacctttaaatcattaccaggaaaaaaagcattaaaagatagagtgaat
atagtcttgactagaagtaaatcttttaatgatgatagattgattgtttgtaattctata
gatgaaactcttaaggaactacaaaaatatgaaaatgataaaatttttataataggtgga
gaaacagtatataaacaatttttaccttattgtaatgaactatatgtaacaaaaatacag
aagacatatgaggcggatagatttttccctaatatagatattatgtcaaactgggatttg
attaaagaaagtgaagtaaaagaatataacaatataagatatgttttttcaacatatata
aataatagtttatag

DBGET integrated database retrieval system