KEGG   Clostridioides difficile CD196: CD196_0056Help
Entry
CD196_0056        CDS       T00997                                 

Definition
(GenBank) dihydrofolate reductase region
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00670  One carbon pool by folate
cdc00790  Folate biosynthesis
cdc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CD196_0056
   00670 One carbon pool by folate
    CD196_0056
Enzymes [BR:cdc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CD196_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 Fer4_12 GrpE
Motif
Other DBs
NCBI-ProteinID: CBA60144
UniProt: A0A0H3MY59
Position
82067..82561
Genome map
AA seq 164 aa AA seqDB search
MKVIVAVDLNWGIGYGGKLLQSIPEDMKFFKEKTVGNVVVMGRETFKSLPGKKALKDRVN
IVLTRSKSFNDDRLIVCNSIDETLKELQKYENDKIFIIGGETVYKQFLPYCNELYVTKIQ
KTYEADRFFPNIDIMSNWDLIKESEVKEYNNIRYVFSTYINNSL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttatagtagctgtagatttaaattggggaattggttatggtggaaagttacta
cagtcgattcctgaagatatgaaattttttaaagaaaaaactgtaggtaatgtagttgta
atggggagagaaacctttaaatcattaccaggaaaaaaagcattaaaagatagagtgaat
atagtcttgactagaagtaaatcttttaatgatgatagattgattgtttgtaattctata
gatgaaactcttaaggaactacaaaaatatgaaaatgataaaatttttataataggtgga
gaaacagtatataaacaatttttaccttattgtaatgaactatatgtaacaaaaatacag
aagacatatgaggcggatagatttttccctaatatagatattatgtcaaactgggatttg
attaaagaaagtgaagtaaaagaatataacaatataagatatgttttttcaacatatata
aataatagtttatag

DBGET integrated database retrieval system