KEGG   Peptoclostridium difficile CD196: CD196_0135Help
Entry
CD196_0135        CDS       T00997                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cdc  Peptoclostridium difficile CD196
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CD196_0135 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CD196_0135 (murA)
Enzymes [BR:cdc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     CD196_0135 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
166272..167543
Genome map
AA seq 423 aa AA seqDB search
MRRSKNMAKIIVKKSNPLKGSVKIDGAKNAVLPIIAATLLANGKSTLNGVPNLRDVHVIS
DLLRHVGAEVEYKENTLTVDASNIKTCEAPYELVRKMRASFLVMGPLLARFNSTKISMPG
GCAIGTRPIDLHLKGFKALGAKIEMDHGFVEAATEKLVGNKLYLDFPSVGATENIMMAAS
LAEGTTIIENAAEEPEIVDLANFLNEMGADVKGAGTNTIKIKGVKELKGAEHNVIPDRIE
AATYMVAAAMTKGDITVENVLMEHLKPVVAKLREAGCEITEMDNSVRVVGPKVLKPIDIK
TLPHPGFPTDVQAQFMAMLTVANGTGVVIETVFENRFMHVAEFNRMGANIKIDGRSAVVN
GVDELHGAAVNATDLRAGAALILCGLIAEGETQIGEIYHIQRGYVDIDKKITALGGQIEI
VED
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaggagatcaaaaaatatggctaagataatagtaaaaaagagtaatccacttaaaggt
agtgttaaaatagatggtgcaaaaaatgcagttttaccaataatagcagcgactttatta
gcaaacggaaaatcaacattaaatggagtaccaaatttaagagatgttcatgttatatca
gatttattaagacatgtaggagcagaagttgaatataaagaaaatacacttactgttgat
gcaagcaatataaaaacttgtgaagctccatatgagcttgtaagaaagatgagagcttct
tttttggttatgggaccattgcttgctagatttaatagtacgaaaatttctatgccagga
ggatgtgctataggaacaagacctatagatttacatttaaaaggatttaaagccttaggt
gcaaagatagaaatggaccatggttttgttgaagcagcaacagaaaagttagtaggaaat
aaattatatttagatttcccatctgttggagcaactgaaaacataatgatggcagcttct
ttagcagaagggactacaataatagagaatgcagcagaagagccagaaatagtagattta
gcaaacttcttgaacgaaatgggagcagatgttaaaggtgcaggtactaatactataaaa
ataaaaggtgttaaagagttaaaaggagcagaacataatgtaattccagacagaatagaa
gcagcaacttatatggttgcagcagctatgacaaaaggtgatataactgttgaaaatgtt
ttaatggagcatttaaaaccagttgtagctaaattaagagaagctggttgcgaaataaca
gaaatggacaattctgtaagagttgtaggtccaaaagtattaaaaccaatagatataaaa
actttaccacatccaggatttcctacagatgttcaagcacaatttatggctatgcttact
gtagccaatggaactggtgtagttatagaaactgtttttgaaaatagatttatgcatgtt
gctgaatttaatagaatgggtgctaatataaaaatagatggaagaagtgcggttgttaat
ggtgtagatgagctacacggtgcagcagtaaacgctactgatttaagagcgggggcagcc
cttattttatgcggtcttatagcagaaggagaaactcaaataggagaaatataccatatc
caaagaggttatgttgatatagataagaagataacagcactaggtggtcaaatcgaaata
gtagaagattaa

DBGET integrated database retrieval system