KEGG   Clostridium difficile CD196: CD196_0307Help
Entry
CD196_0307        CDS       T00997                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cdc  Clostridium difficile CD196
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cdc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
351174..352481
Genome map
AA seq 435 aa AA seqDB search
MDISRSVDNSLNRTIEFLKELIKIDSQQGEPISQCPFGIGPKKSLDKTLDYCASLGFSVK
NIDNYIGYAEIGEGEELIGIPMHLDIVPPGEGWSVDPFSGAVIDNIIYGRGVIDNKGAVS
MLIHVLKNIEDMYPTINKRIRLIFGTNEETDMKCIKYYLDKGEEIPSMGFTPDAMYPVVN
GEKGRVHIRIEKEIKIDKSKPYIIVRGGTKENVVPSHCTAKIINGIISELTTKGVAVHAS
NPEKGENAISKMVIKIVEDNMDFQHREDIELVSKYLCSDYYGDALGINQYDEVFKNTTLN
LGILKVNEEKIVCELDIRYGKNIVLNNIIDRFKKVFCNGWKIEVIAHKDLHYVDESNLVL
KKLLEAYEEVTDENGYTIAMGGGTYASWFKDMVAFGPKFLAYKTGGHGVDERVPINHIRK
NMEIYTLALIKLLEL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggatataagcagaagtgtagataatagtttaaatagaaccatagaatttctaaaagaa
ttgataaaaattgattcacaacaaggtgaacctatttcacaatgtccttttggtatagga
cctaaaaaatctttagataaaactttagattactgtgctagtttaggttttagtgttaaa
aatattgataattatattggatatgcagaaattggagagggagaggaattaatagggatt
ccaatgcatttagatatagttccaccaggagaggggtggagtgtagacccattttcggga
gcagtaattgacaatattatttatggaagaggtgtcatagataataagggtgctgtatct
atgcttatacatgtattgaaaaacatagaggatatgtatcctacaattaataaaagaata
agattaatttttggtacaaatgaggagacagatatgaaatgtatcaaatattacttagat
aaaggtgaagaaattccaagtatgggatttactccagatgctatgtatccagtggttaat
ggagaaaaaggaagggttcatataaggatagaaaaagaaattaaaattgacaaaagtaaa
ccttacataatagtaaggggaggaactaaagaaaatgttgttccatctcattgtactgca
aaaattattaatggaattatttcagagttaactactaaaggagtagctgtacatgcaagt
aatcctgaaaagggagaaaatgctatatctaaaatggtaataaagatagttgaggataat
atggattttcagcatagagaagatatagaattagtttcaaaatacctttgtagtgattat
tatggagatgcattggggattaatcaatatgatgaggtattcaaaaacactaccttaaat
ttaggaatattaaaagtaaatgaggaaaaaatcgtatgtgagttagatataaggtatggt
aaaaatatagttttaaataacataatagatagattcaaaaaggttttttgtaatggttgg
aaaatagaggttattgctcataaagacttacattatgtggatgagagtaatttagtactt
aaaaaattattagaagcctatgaagaagtaacagatgaaaatggatatacaattgctatg
ggtggtggcacatatgcaagttggtttaaagatatggtggcgtttggacctaagttctta
gcgtataaaactggtggtcatggagtagatgaaagagtaccaataaatcatatacgaaag
aatatggagatatatactttggctttaataaaactattagaattgtaa

DBGET integrated database retrieval system