KEGG   Clostridioides difficile CD196: CD196_0353Help
Entry
CD196_0353        CDS       T00997                                 

Gene name
adhE
Definition
(GenBank) aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00010  Glycolysis / Gluconeogenesis
cdc00071  Fatty acid degradation
cdc00350  Tyrosine metabolism
cdc00620  Pyruvate metabolism
cdc00625  Chloroalkane and chloroalkene degradation
cdc00626  Naphthalene degradation
cdc00650  Butanoate metabolism
cdc01100  Metabolic pathways
cdc01110  Biosynthesis of secondary metabolites
cdc01120  Microbial metabolism in diverse environments
cdc01130  Biosynthesis of antibiotics
cdc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD196_0353 (adhE)
   00620 Pyruvate metabolism
    CD196_0353 (adhE)
   00650 Butanoate metabolism
    CD196_0353 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    CD196_0353 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CD196_0353 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CD196_0353 (adhE)
   00626 Naphthalene degradation
    CD196_0353 (adhE)
Enzymes [BR:cdc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CD196_0353 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CD196_0353 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CBA60696
UniProt: A0A0H3N3N3
Position
407661..410333
Genome map
AA seq 890 aa AA seqDB search
MHNYFREVFSMEKKEKVVEKSNVEVCSPEIVNSVETLRMRLEEIRLAQKEFATFTQEQVD
KIFLAASTAANQQRIPLAKMAVEETGMGIVEDKVIKNHFASEYIYNAYKDTKTCGVIEKD
EAFGFTRIAEPVGVLSAVIPTTNPTSTAIFKSLIALKTRNGIIFSPHPRAKNCTIEAARV
VHDAAVKAGAPKGLIGWVDVPSIELTNVVMAEADLILATGGPGMVKSAYSSGKPAVGVGP
GNVPAIIDESADIKMAVSSILVSKSFDNGMICASEQAVIVPEKIYEEVKKEFKYRGAHFL
NKEETEKVGKVVIIDGSLNARIVGQPAHVIAKMADVEVPKTARIIIGEVESVELNEPFAH
EKLSPVLAMYKSKSFEDAVAKAEKLVADGGYGHTSSLYADSINHPDRVEKFVNAMKTCRV
LVNTPSSQGGIGDLYNFKLAPSLTLGCGSWGGNSVSENVGVKHLLNIKTVAERRENMLWF
RAPEKVYFKKGCLGVAAREFKDVMDKKKAFIVTDSFLYNNGYTKKLTDLLDEMGIKHTTF
FDVAPDPTLACAREGAKAMADFQPDLIIAVGGGSAMDAGKIMWVMYEHPEVDFQDLAMRF
MDIRKRVYVFPKMGEKAYFAAIPTSAGTGSEVTPFAVITDQDSGVKYPLADYELMPNMAI
IDADMMMEMPPRLTAASGVDALTHALEAYVSMLRTEPADGLALQAGKIIFEYLPRAYKNG
KNDKEAREKMAMASTMAGMSFANAFLGICHSLAHKLGAFHHVQHGVANALLINEVIKFNC
AEAPNKMGAFSQYRYPDCIQRYAEFASFAGIKGNTDQEKVDNLIKAIDELKARVGLPKTI
KEAGVEESKFLETLDVMVEQAFDDQCTGANPRYPLMSELKEIYLKVYYGK
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgcataattattttagggaggtttttagtatggagaaaaaagaaaaggtagtagaaaaa
tcaaatgttgaagtatgtagtcctgaaattgtcaacagtgttgaaacattaagaatgaga
ttagaagaaattagattggcacaaaaagaatttgcaacatttacgcaagaacaggtagat
aagattttcttagctgcttcaactgcagctaatcaacaaagaatacctctagcaaaaatg
gcagtggaagagactggtatgggtattgttgaagataaggttataaaaaaccattttgcc
tcagaatatatctataatgcttataaagatactaaaacttgtggtgtcatagaaaaagat
gaagcatttggttttacaagaattgctgagccagtaggtgttttatcagcagttatacca
acaactaatcctacatcaactgcaatattcaaatccctaatagcactaaaaactagaaat
ggtataattttctctcctcatccaagagctaaaaactgtactatagaagcagctagagtt
gtacatgatgcggcagttaaggcaggagcaccaaaaggacttataggttgggtagatgtt
ccttcgattgaattaactaatgttgtcatggcagaggcagaccttatattagctactggt
ggacctggaatggttaaatctgcatactcttcaggtaaaccagctgttggagttgggcct
ggaaatgtacctgcaataatagatgagagtgcagatataaaaatggctgtaagttcaatc
ttagtatcaaaatcattcgataatggtatgatatgtgcttccgagcaagctgtaatagta
ccagaaaaaatatatgaagaagttaaaaaagaatttaaataccgtggagcacatttccta
aataaagaagaaactgaaaaagtaggaaaagtagtaataattgatggttcattaaatgcc
agaatagttggacaaccagcacatgtaatagccaaaatggcggatgtagaagttccaaaa
acagctagaataataattggtgaagtagaatctgttgaattaaatgaaccttttgcacat
gaaaaactttctcctgtacttgcaatgtacaaatctaaaagttttgaagatgcagttgct
aaagctgaaaaattagttgcagatggtggatatggccatacatcttcgttatatgcagac
tctataaatcatccagatagagtagagaagtttgtaaatgctatgaaaacttgtagagta
ttagttaatactccatcgtcacaaggtggtataggtgacttatataactttaaattagca
ccatctcttactcttggttgtggttcttggggtggaaactcagtatctgaaaacgtggga
gtgaaacatttacttaatatcaagacagtagctgaaaggagagagaatatgctttggttt
agagcaccagaaaaggtttatttcaaaaaaggttgtttaggtgtagcagcaagagaattt
aaagatgttatggataaaaagaaagcctttatagtaacagattctttcctttacaataat
ggatacactaagaagctaactgatttgttggatgagatgggaattaagcatactacattc
tttgatgttgctccagacccaacattagcttgtgcaagagaaggagctaaggctatggct
gatttccaaccagatttaataatagctgtaggtggaggtagcgcaatggatgctggtaag
ataatgtgggtaatgtatgagcatccagaggtagacttccaagatttggctatgagattt
atggatataagaaaaagagtatatgtatttcctaagatgggtgaaaaagcgtattttgct
gctatcccaacttcagcaggaactggttcagaagtaactccatttgcagttataactgac
caagattcaggtgtaaagtacccattagcagattatgaattaatgccaaacatggctata
attgatgctgatatgatgatggagatgccaccaagattaacagcagcatcaggtgttgat
gctttaacacatgcattagaagcatatgtatctatgttaagaactgaaccagctgacggt
ctagcactacaagcaggtaaaataatatttgaatatctacctcgtgcatacaaaaatgga
aagaatgataaagaagcaagagaaaaaatggcaatggcatctactatggcaggaatgtct
tttgcaaatgccttcttaggaatatgtcactctttagcacataaattaggtgcattccac
catgttcaacacggtgttgcaaatgcattattaataaatgaagtaattaagttcaattgt
gcagaagctccaaataagatgggtgcattctcacaatacagatatcctgattgtatacaa
agatatgctgaatttgcttcttttgcaggaatcaagggaaatacagaccaagaaaaagta
gataaccttataaaagcaatagatgaattaaaggcaagagtaggacttcctaaaactata
aaagaggctggagtagaagaatctaaattcttagaaacattggatgttatggttgaacaa
gcttttgatgaccaatgtacaggtgctaatcctagatacccattgatgagtgaattaaaa
gagatatatctaaaagtttattatggtaaataa

DBGET integrated database retrieval system