KEGG   Clostridium difficile CD196: CD196_0482Help
Entry
CD196_0482        CDS       T00997                                 

Definition
chemotaxis-related protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cdc  Clostridium difficile CD196
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cdc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cdc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
566920..567498
Genome map
AA seq 192 aa AA seqDB search
MVIAIGASVGGTEAILEIIKDLPKSTPGIVVVQHMPAIFTYMYAQRLDKQCIMNVREAKN
NDRVEQGNVLIAPGGYQMKLCTDKQGYYVTCEKGERISGHCPSVDVLFDSVAEVAGKNSI
GIILTGMGYDGANGLLKMKENGLFTIGQDENSCIVYGMPMVAFDRGSVMLQLPLGEISNC
LIRHINILKQKD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggttattgctataggcgcatctgtaggtggtacagaagcaatacttgaaattataaaa
gacctaccaaaatcaacaccagggattgttgtagttcaacatatgccagctatatttact
tatatgtatgcacaacggcttgacaagcagtgtattatgaatgtaagagaagctaagaat
aatgatagagtcgaacaaggaaatgtgttaattgcacctgggggttaccagatgaaattg
tgtacggataaacaaggatattatgtaacttgtgaaaaaggagaaagaataagtggtcac
tgtccatcagtagacgttttgtttgattcagtagcagaagtagcaggtaaaaattcaata
ggaataatacttacaggtatgggttatgatggagcaaatggacttttaaaaatgaaagaa
aatggtttatttacaattggacaggatgaaaattcttgtatagtatatggaatgccaatg
gtagcttttgatagaggttctgttatgttacaattacctcttggtgaaatttcaaactgt
ttgataagacatattaatattttaaaacaaaaagattaa

DBGET integrated database retrieval system