KEGG   Peptoclostridium difficile CD196: CD196_0482Help
Entry
CD196_0482        CDS       T00997                                 

Definition
chemotaxis-related protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cdc  Peptoclostridium difficile CD196
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CD196_0482
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CD196_0482
Enzymes [BR:cdc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CD196_0482
Two-component system [BR:cdc02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CD196_0482
Bacterial motility proteins [BR:cdc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CD196_0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
566920..567498
Genome map
AA seq 192 aa AA seqDB search
MVIAIGASVGGTEAILEIIKDLPKSTPGIVVVQHMPAIFTYMYAQRLDKQCIMNVREAKN
NDRVEQGNVLIAPGGYQMKLCTDKQGYYVTCEKGERISGHCPSVDVLFDSVAEVAGKNSI
GIILTGMGYDGANGLLKMKENGLFTIGQDENSCIVYGMPMVAFDRGSVMLQLPLGEISNC
LIRHINILKQKD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggttattgctataggcgcatctgtaggtggtacagaagcaatacttgaaattataaaa
gacctaccaaaatcaacaccagggattgttgtagttcaacatatgccagctatatttact
tatatgtatgcacaacggcttgacaagcagtgtattatgaatgtaagagaagctaagaat
aatgatagagtcgaacaaggaaatgtgttaattgcacctgggggttaccagatgaaattg
tgtacggataaacaaggatattatgtaacttgtgaaaaaggagaaagaataagtggtcac
tgtccatcagtagacgttttgtttgattcagtagcagaagtagcaggtaaaaattcaata
ggaataatacttacaggtatgggttatgatggagcaaatggacttttaaaaatgaaagaa
aatggtttatttacaattggacaggatgaaaattcttgtatagtatatggaatgccaatg
gtagcttttgatagaggttctgttatgttacaattacctcttggtgaaatttcaaactgt
ttgataagacatattaatattttaaaacaaaaagattaa

DBGET integrated database retrieval system