KEGG   Clostridioides difficile CD196: CD196_0482Help
Entry
CD196_0482        CDS       T00997                                 

Definition
(GenBank) putative chemotaxis-related protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc02020  Two-component system
cdc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CD196_0482
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CD196_0482
Enzymes [BR:cdc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CD196_0482
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     CD196_0482
Two-component system [BR:cdc02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CD196_0482
Bacterial motility proteins [BR:cdc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CD196_0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-ProteinID: CBA60939
UniProt: A0A0H3N8M7
Position
566920..567498
Genome map
AA seq 192 aa AA seqDB search
MVIAIGASVGGTEAILEIIKDLPKSTPGIVVVQHMPAIFTYMYAQRLDKQCIMNVREAKN
NDRVEQGNVLIAPGGYQMKLCTDKQGYYVTCEKGERISGHCPSVDVLFDSVAEVAGKNSI
GIILTGMGYDGANGLLKMKENGLFTIGQDENSCIVYGMPMVAFDRGSVMLQLPLGEISNC
LIRHINILKQKD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggttattgctataggcgcatctgtaggtggtacagaagcaatacttgaaattataaaa
gacctaccaaaatcaacaccagggattgttgtagttcaacatatgccagctatatttact
tatatgtatgcacaacggcttgacaagcagtgtattatgaatgtaagagaagctaagaat
aatgatagagtcgaacaaggaaatgtgttaattgcacctgggggttaccagatgaaattg
tgtacggataaacaaggatattatgtaacttgtgaaaaaggagaaagaataagtggtcac
tgtccatcagtagacgttttgtttgattcagtagcagaagtagcaggtaaaaattcaata
ggaataatacttacaggtatgggttatgatggagcaaatggacttttaaaaatgaaagaa
aatggtttatttacaattggacaggatgaaaattcttgtatagtatatggaatgccaatg
gtagcttttgatagaggttctgttatgttacaattacctcttggtgaaatttcaaactgt
ttgataagacatattaatattttaaaacaaaaagattaa

DBGET integrated database retrieval system