KEGG   Clostridioides difficile CD196: CD196_0499Help
Entry
CD196_0499        CDS       T00997                                 

Gene name
glsA
Definition
(GenBank) probable glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00220  Arginine biosynthesis
cdc00250  Alanine, aspartate and glutamate metabolism
cdc00471  D-Glutamine and D-glutamate metabolism
cdc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CD196_0499 (glsA)
   00220 Arginine biosynthesis
    CD196_0499 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CD196_0499 (glsA)
Enzymes [BR:cdc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CD196_0499 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CBA60970
UniProt: A0A0H3N065
Position
584358..585287
Genome map
AA seq 309 aa AA seqDB search
MNTLDETLLKEIISSNKKYTNYGQVASYIPELKNARRNDLGICIIDSENNLYSAGNCSTK
FTIQSISKPIVLAMALMDNDWEDVFSNVGMEPSGDPFNSIMKLEINDTKKPCNPMINAGA
IVTTSLINGSCLEEKEERMLSFFRKLAKNDNIGINYDVYKSEKMTGDRNRAMAYLLKSDG
FIRGNVEDVLDLYFKQCSIEIDSVDLARIGINLANYGVDIENGEHLMSEMVSRIVKTFMM
TCGMYDASGEFAIKVGIPAKSGVGGGIMASVPGRMGIGVYGPALDKKGNSVAGVKVLEEL
SNKLKLNIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgttagatgagacattattaaaagaaattataagttctaataagaagtatact
aattatgggcaagtcgctagttacataccagaattaaaaaacgctagaagaaatgattta
ggaatttgtatcatagatagcgaaaataatctttatagtgctggaaactgtagcacaaag
tttactatacaaagtatttcaaaaccaattgtgcttgctatggcacttatggataatgat
tgggaagacgttttttcaaacgttggaatggagccaagtggggacccatttaattcaata
atgaaacttgaaattaatgacacaaaaaaaccctgtaatccaatgataaatgcaggggct
atagtaactacttcccttataaatgggagttgtttagaagaaaaagaagaaagaatgctt
agtttctttagaaagttagcaaaaaatgataatataggaataaactatgatgtctataag
tctgaaaaaatgactggagatagaaacagagctatggcttacttattgaaaagtgatgga
tttatcagagggaatgtagaagatgttctagacctttattttaaacaatgctcaattgag
atagattctgtagatttagcgagaattggaataaatcttgcaaattatggagtagatata
gaaaatggtgagcatttaatgagtgaaatggtttctaggattgtcaagacatttatgatg
acttgtggaatgtatgatgcttctggggaatttgctattaaagttggcattcctgcaaaa
tctggagttgggggtggtataatggcttctgtgccgggacgcatggggattggtgtttat
ggacctgcgcttgacaaaaaaggtaacagcgtcgcaggagttaaagttttagaggagttg
tcaaataaactcaaattaaatattttttaa

DBGET integrated database retrieval system