KEGG   Clostridium difficile CD196: CD196_0688Help
Entry
CD196_0688        CDS       T00997                                 

Gene name
glpK1
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cdc  Clostridium difficile CD196
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cdc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
830167..831693
Genome map
AA seq 508 aa AA seqDB search
MKYVLAIDQGTTGTRAVLINEKSEFVFSDYMEHTQIYPQSGYVEHDPIEIWNNTKTVSNN
VLQQAFESGINESDIKGIGIDNQGETVMLWDKNTGKPLYNAIVWQCRRTYDYVENLKNIP
GLENKIIDKTGLIIDPYFSGTKIKWVIDNVKGVKEKIKNGEVLAGTLDSWLIWKMTGGKS
FLTDVSTAARTMLFNIRDMDWDRELLDIIGVPRSILADIMPTSGDFGTTDKEAFCGVSIK
ITASMVDQPAALFGNGCFEPGMVKNTYGTGCFLYMNIGEELNIAGNGILTTVAWKIGDKV
TYAYDGGVYIAGAAIQWLRDGIGVIKNYSETDDMANSISSTGGVYFVPAFAGIAAPYWDQ
YARGTMVGITGSTKKEHIVRATLESVALQVKDVVDSMNLASGKEIKMLRVDGGITKNNFT
MQFQSDILDIPIEIAENPETTVLGVGYMAGLSCGVWNSIDEIRSEFTISKKYIPNMTKQK
REEILLGWNQAVKRAMNWENDTKKVCAN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatgtattagcaattgaccaaggaacaacaggaacaagagcagtattgataaac
gaaaaatcagagtttgtttttagcgattatatggaacatactcaaatatatccacaatct
ggatatgttgaacatgaccctatagaaatttggaataatacaaaaactgtgagtaataat
gtattacaacaggcttttgaaagtggaatcaatgaaagtgatataaaaggaattggtata
gataatcaaggtgaaacagtaatgttatgggataaaaatacaggtaaaccactttacaat
gctatcgtatggcagtgtaggagaacttatgattatgtggaaaatttaaagaatatacca
ggtttagaaaataagataatagataagactgggttaattatagacccatatttctcaggt
acaaaaattaaatgggtaatagataatgtaaaaggtgtaaaagaaaaaattaaaaatgga
gaagtacttgcaggaacattggatagttggttaatatggaaaatgacaggaggaaaatct
tttttaactgatgtatctacagcagcaagaacaatgctttttaatataagagatatggat
tgggatagagagttgcttgacattataggagtgcctagaagtattttagcagatataatg
cctactagtggtgattttggaactacagataaggaggcattttgtggggtttctataaaa
attactgcttcaatggtagaccaaccagcagctttatttggcaatggatgttttgaacca
ggaatggttaaaaatacttatggtacaggatgtttcttatatatgaatataggtgaggag
ttaaatatagcaggtaatggtattttgacaacagttgcttggaagataggagataaagtt
acatatgcttatgatggtggagtgtatatagcaggtgctgcaatacaatggcttagagat
ggaattggagttataaaaaattattcagaaactgatgacatggcaaattccatatcaagt
actggaggggtatattttgtaccagcatttgcaggtatagcagcaccttattgggaccaa
tatgctagaggcacaatggttgggataacaggaagtactaaaaaagaacatatagtaagg
gctactcttgagtctgttgcacttcaagtcaaggatgttgttgattccatgaatttggct
tcagggaaagaaataaaaatgttgagagtagatggtggaattactaaaaataactttaca
atgcaatttcaatctgacatattagatataccaattgaaattgcagaaaatcctgaaacg
acagtacttggtgtagggtatatggcagggctttcctgtggtgtttggaacagtattgat
gaaattagaagtgaatttacaataagcaaaaaatatattccaaatatgactaagcaaaaa
agagaagaaatattacttggatggaatcaagcagtaaaaagagctatgaattgggaaaac
gataccaaaaaggtgtgtgctaattaa

DBGET integrated database retrieval system