KEGG   Clostridioides difficile CD196: CD196_0936Help
Entry
CD196_0936        CDS       T00997                                 

Gene name
thlA1
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdc  Clostridioides difficile CD196
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CD196_0936 (thlA1)
   00630 Glyoxylate and dicarboxylate metabolism
    CD196_0936 (thlA1)
   00640 Propanoate metabolism
    CD196_0936 (thlA1)
   00650 Butanoate metabolism
    CD196_0936 (thlA1)
  Lipid metabolism
   00071 Fatty acid degradation
    CD196_0936 (thlA1)
   00072 Synthesis and degradation of ketone bodies
    CD196_0936 (thlA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CD196_0936 (thlA1)
   00310 Lysine degradation
    CD196_0936 (thlA1)
   00380 Tryptophan metabolism
    CD196_0936 (thlA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD196_0936 (thlA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CD196_0936 (thlA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CD196_0936 (thlA1)
Enzymes [BR:cdc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CD196_0936 (thlA1)
Exosome [BR:cdc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CD196_0936 (thlA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1132899..1134089
Genome map
AA seq 396 aa AA seqDB search
MGVMNMREVVIASAARTAVGSFGGAFKSVSAVELGVTAAKEAIKRANITPDMIDESLLGG
VLTAGLGQNIARQIALGAGIPVEKPAMTINIVCGSGLRSVSMASQLIALGDADIMLVGGA
ENMSMSPYLVPSARYGARMGDAAFVDSMIKDGLSDIFNNYHMGITAENIAEQWNITREEQ
DELALASQNKAEKAQAEGKFDEEIVPVVIKGRKGDTVVDKDEYIKPGTTMEKLAKLRPAF
KKDGTVTAGNASGINDGAAMLVVMAKEKAEELGIEPLATIVSYGTAGVDPKIMGYGPVPA
TKKALEAANMTIEDIDLVEANEAFAAQSVAVIRDLNIDMNKVNVNGGAIAIGHPIGCSGA
RILTTLLYEMKRRDAKTGLATLCIGGGMGTTLIVKR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggggtaatgaatatgagagaagtagtaattgccagtgcagctagaacagcagtagga
agttttggaggagcatttaaatcagtttcagcggtagagttaggggtaacagcagctaaa
gaagctataaaaagagctaacataactccagatatgatagatgaatctcttttaggggga
gtacttacagcaggtcttggacaaaatatagcaagacaaatagcattaggagcaggaata
ccagtagaaaaaccagctatgactataaatatagtttgtggttctggattaagatctgtt
tcaatggcatctcaacttatagcattaggtgatgctgatataatgttagttggtggagct
gaaaatatgagtatgtctccttatttagtaccaagtgcgagatatggtgcaagaatgggt
gatgctgcttttgttgattcaatgataaaagatggattatcagacatatttaataactat
cacatgggtattactgctgaaaacatagcagagcaatggaatataactagagaagaacaa
gatgaattagctcttgcaagtcaaaataaagctgaaaaagctcaagctgaaggaaaattt
gatgaagaaatagttcctgttgttataaaaggaagaaaaggtgacactgtagtagataaa
gatgaatatattaagcctggcactacaatggaaaaacttgctaagttaagacctgcattt
aaaaaagatggaacagttactgctggtaatgcatcaggaataaatgatggtgctgctatg
ctagtagtaatggctaaagaaaaagctgaagaactaggaatagagcctcttgcaactata
gtttcttatggaacagctggtgttgaccctaaaataatgggatatggaccagttccagca
actaaaaaagctttagaagctgctaatatgactattgaagatatagatttagttgaagct
aatgaggcatttgctgcccaatctgtagctgtaataagagacttaaatatagatatgaat
aaagttaatgttaatggtggagcaatagctataggacatccaataggatgctcaggagca
agaatacttactacacttttatatgaaatgaagagaagagatgctaaaactggtcttgct
acactttgtataggtggtggaatgggaactactttaatagttaagagatag

DBGET integrated database retrieval system