KEGG   Clostridium difficile CD196: CD196_1051Help
Entry
CD196_1051        CDS       T00997                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cdc  Clostridium difficile CD196
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cdc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cdc00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cdc00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cdc00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:cdc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1250228..1252213
Genome map
AA seq 661 aa AA seqDB search
MKNLCKISDDYLNSKLKYLKLLSKQYPSISKASTEIINLEAILNLPKGTEHFITDVHGEY
EPFVHVLKNGSGVIKRKIEELFSNTIRDSEKKMLATLVYYPEQKLDLIIKQEENIDDFYR
INIYRLIELCKYASSKYTRSKVRKLLPENFKYIIEELLHEHVKSEHKEEYYKSIVETIVD
IGIAKEFIIAISTVIQKLVVDRLHVIGDIYDRGPRPDIIVDKLIEHHCVDIQWGNHDILW
MGAASGEKTCIANALRISARYANLDIVEDIYGINLLPLATFAIEMYKDDPCKEFIPKVND
QSVTTTEKSLMAKMHKAISIIQFKLEGEVIRRRPEFEMEHRLLLNMINYDEGTITLKGKT
YKLKDTYLPTIDKKDPYKLTMEERNVIDKLVSSFRGSEKLQKHVSFLFSKGSIYLKANSN
LLIHGCVPLNEDGSFMSMNIMGKEYKGKALMDKMESLAREGFFFKDKAEEKLYGMDIMWY
LWTGKCSSLFGKDDMTTFERYFIEEKETHKENKNPYFKLRENEMACKRLFEEFDLELDES
HIINGHVPVESKNGESPIKANGKILVIDGGFSRAYQKTTGIAGYTLIYNSRTLQLVSHEP
FNSAEEAIANESDILSTTVVVEHKAKRKMVRDTDEGVKIQEEIEDLKLLLMAYKKGLIKE
M
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctgtgtaaaatatcagatgattatttaaacagcaagcttaagtatttaaag
ttattatcaaaacaatatccaagtatatcaaaagcaagtacagaaataataaatttagag
gctatattaaatcttccaaagggaacagagcattttataacagatgtacatggtgaatat
gaaccatttgtacatgtattaaaaaatggttctggtgtaataaagagaaaaatagaagaa
ttgttttcaaatacaataagagacagcgaaaaaaaaatgttagcaactcttgtatattat
cctgaacaaaagttagacctaataattaagcaagaggaaaatatagatgatttttataga
ataaatatttatagacttatagaactttgtaaatatgcttctagcaaatatactaggtct
aaagttagaaaactgttaccagaaaattttaaatacataatagaagaacttttgcatgag
catgttaaaagtgaacataaagaagagtattataaaagtatagttgaaacaatagttgac
ataggaatagctaaggagtttataattgctatttctacagttatacaaaaattggttgta
gatagacttcatgtaataggagatatttatgatagaggtccaagaccagatataattgtc
gataagcttattgaacatcattgtgtggatattcaatggggaaatcatgatatattgtgg
atgggtgcagcctcaggtgaaaaaacttgtatagcaaatgcactgaggatatcagctaga
tatgcgaatttagacattgtagaagacatatatggaataaatctgttgcctttagccact
tttgctatagaaatgtataaagatgacccttgtaaagaatttattccaaaggttaatgac
caaagtgtaacaacaacagaaaagtctttaatggcaaaaatgcacaaagcaataagtata
attcaatttaagcttgaaggtgaggttataagacgaagacctgaatttgaaatggaacat
agacttttgcttaatatgataaactatgatgaaggtacgattactttaaaaggtaaaaca
tataaattaaaagatacttatttacctacaatagacaaaaaagacccatataaattaact
atggaagaaagaaatgttattgataaattagtatcttcatttagaggtagtgaaaaatta
caaaaacatgtttcatttttgttttctaaaggaagtatatatttaaaggctaactcaaat
ttactgattcatggatgtgtaccattaaatgaagatggaagctttatgtctatgaatata
atgggaaaagagtataaaggtaaggctcttatggataagatggagtctctagcaagagaa
ggatttttctttaaagataaggcagaagaaaaactatatggtatggatattatgtggtat
ttatggactgggaaatgttcatcattatttggtaaagatgatatgactacatttgaaaga
tactttatagaagaaaaagagactcataaagaaaataagaatccatattttaaacttaga
gaaaatgagatggcttgtaaaagattatttgaagaatttgatttagagcttgatgaatcc
catataataaatggtcatgttcctgtggagagtaaaaatggagagagcccaataaaagct
aatggtaaaattctcgttatagatggtggtttttctagggcttaccaaaaaactactggt
atagctggatacactttgatatacaattctagaactttgcaattagtatcgcatgaacca
tttaattctgctgaagaagccattgcaaatgaaagtgatatcttatcgacaactgttgta
gtagagcataaggcaaagagaaaaatggtgagagatactgatgaaggagtaaaaatacaa
gaggaaatagaagatttaaaactacttttaatggcttataagaaagggctaataaaagaa
atgtag

DBGET integrated database retrieval system