KEGG   Clostridioides difficile CD196: CD196_1051Help
Entry
CD196_1051        CDS       T00997                                 

Gene name
fbp
Definition
(GenBank) putative fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00010  Glycolysis / Gluconeogenesis
cdc00030  Pentose phosphate pathway
cdc00051  Fructose and mannose metabolism
cdc00680  Methane metabolism
cdc01100  Metabolic pathways
cdc01110  Biosynthesis of secondary metabolites
cdc01120  Microbial metabolism in diverse environments
cdc01130  Biosynthesis of antibiotics
cdc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD196_1051 (fbp)
   00030 Pentose phosphate pathway
    CD196_1051 (fbp)
   00051 Fructose and mannose metabolism
    CD196_1051 (fbp)
  Energy metabolism
   00680 Methane metabolism
    CD196_1051 (fbp)
Enzymes [BR:cdc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CD196_1051 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: CBA61996
UniProt: A0A0H3NAB3
Position
1250228..1252213
Genome map
AA seq 661 aa AA seqDB search
MKNLCKISDDYLNSKLKYLKLLSKQYPSISKASTEIINLEAILNLPKGTEHFITDVHGEY
EPFVHVLKNGSGVIKRKIEELFSNTIRDSEKKMLATLVYYPEQKLDLIIKQEENIDDFYR
INIYRLIELCKYASSKYTRSKVRKLLPENFKYIIEELLHEHVKSEHKEEYYKSIVETIVD
IGIAKEFIIAISTVIQKLVVDRLHVIGDIYDRGPRPDIIVDKLIEHHCVDIQWGNHDILW
MGAASGEKTCIANALRISARYANLDIVEDIYGINLLPLATFAIEMYKDDPCKEFIPKVND
QSVTTTEKSLMAKMHKAISIIQFKLEGEVIRRRPEFEMEHRLLLNMINYDEGTITLKGKT
YKLKDTYLPTIDKKDPYKLTMEERNVIDKLVSSFRGSEKLQKHVSFLFSKGSIYLKANSN
LLIHGCVPLNEDGSFMSMNIMGKEYKGKALMDKMESLAREGFFFKDKAEEKLYGMDIMWY
LWTGKCSSLFGKDDMTTFERYFIEEKETHKENKNPYFKLRENEMACKRLFEEFDLELDES
HIINGHVPVESKNGESPIKANGKILVIDGGFSRAYQKTTGIAGYTLIYNSRTLQLVSHEP
FNSAEEAIANESDILSTTVVVEHKAKRKMVRDTDEGVKIQEEIEDLKLLLMAYKKGLIKE
M
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctgtgtaaaatatcagatgattatttaaacagcaagcttaagtatttaaag
ttattatcaaaacaatatccaagtatatcaaaagcaagtacagaaataataaatttagag
gctatattaaatcttccaaagggaacagagcattttataacagatgtacatggtgaatat
gaaccatttgtacatgtattaaaaaatggttctggtgtaataaagagaaaaatagaagaa
ttgttttcaaatacaataagagacagcgaaaaaaaaatgttagcaactcttgtatattat
cctgaacaaaagttagacctaataattaagcaagaggaaaatatagatgatttttataga
ataaatatttatagacttatagaactttgtaaatatgcttctagcaaatatactaggtct
aaagttagaaaactgttaccagaaaattttaaatacataatagaagaacttttgcatgag
catgttaaaagtgaacataaagaagagtattataaaagtatagttgaaacaatagttgac
ataggaatagctaaggagtttataattgctatttctacagttatacaaaaattggttgta
gatagacttcatgtaataggagatatttatgatagaggtccaagaccagatataattgtc
gataagcttattgaacatcattgtgtggatattcaatggggaaatcatgatatattgtgg
atgggtgcagcctcaggtgaaaaaacttgtatagcaaatgcactgaggatatcagctaga
tatgcgaatttagacattgtagaagacatatatggaataaatctgttgcctttagccact
tttgctatagaaatgtataaagatgacccttgtaaagaatttattccaaaggttaatgac
caaagtgtaacaacaacagaaaagtctttaatggcaaaaatgcacaaagcaataagtata
attcaatttaagcttgaaggtgaggttataagacgaagacctgaatttgaaatggaacat
agacttttgcttaatatgataaactatgatgaaggtacgattactttaaaaggtaaaaca
tataaattaaaagatacttatttacctacaatagacaaaaaagacccatataaattaact
atggaagaaagaaatgttattgataaattagtatcttcatttagaggtagtgaaaaatta
caaaaacatgtttcatttttgttttctaaaggaagtatatatttaaaggctaactcaaat
ttactgattcatggatgtgtaccattaaatgaagatggaagctttatgtctatgaatata
atgggaaaagagtataaaggtaaggctcttatggataagatggagtctctagcaagagaa
ggatttttctttaaagataaggcagaagaaaaactatatggtatggatattatgtggtat
ttatggactgggaaatgttcatcattatttggtaaagatgatatgactacatttgaaaga
tactttatagaagaaaaagagactcataaagaaaataagaatccatattttaaacttaga
gaaaatgagatggcttgtaaaagattatttgaagaatttgatttagagcttgatgaatcc
catataataaatggtcatgttcctgtggagagtaaaaatggagagagcccaataaaagct
aatggtaaaattctcgttatagatggtggtttttctagggcttaccaaaaaactactggt
atagctggatacactttgatatacaattctagaactttgcaattagtatcgcatgaacca
tttaattctgctgaagaagccattgcaaatgaaagtgatatcttatcgacaactgttgta
gtagagcataaggcaaagagaaaaatggtgagagatactgatgaaggagtaaaaatacaa
gaggaaatagaagatttaaaactacttttaatggcttataagaaagggctaataaaagaa
atgtag

DBGET integrated database retrieval system