KEGG   Clostridium difficile CD196: CD196_1321Help
Entry
CD196_1321        CDS       T00997                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cdc  Clostridium difficile CD196
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cdc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1540895..1541467
Genome map
AA seq 190 aa AA seqDB search
MNKVDKEKIQHAVREILEAIGEDPDREGLIETPNRVARMYEEIFSGLSEEPRDHLKVLFA
DEKHEELVLVKDIPFYSCCEHHLVPFFGKAHIAYLPKGGRLTGLSKLARVIDTLAKRPQL
QERITKNAADIIMEELQPYGVLVVVEAEHMCMTMRGVKKPGSKTVTSAVRGIFEKDIASR
AEAMSLITMK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagttgataaagaaaagatacaacatgcagtaagagaaatactagaggcaatt
ggagaagacccagatagagaaggtctaatcgagactccaaatagagttgctaggatgtat
gaagagatattctctggtcttagtgaagaaccaagagaccatttaaaagttctttttgca
gatgaaaaacatgaagaattagtattggtaaaagatattccattttattcatgttgtgag
catcatctagttcctttctttggaaaagctcatattgcttatttaccaaaaggaggaaga
cttacagggctttctaaacttgctagagtaatagatacattggcaaaaagaccacaatta
caagaaagaatcactaaaaatgctgcagatataataatggaagaattacaaccttatggt
gtcttagtagtagtagaagctgaacatatgtgtatgacaatgagaggtgtaaaaaaacca
ggttcaaaaactgttacatcagcagtgagaggaatatttgaaaaggacattgcgtctaga
gccgaggctatgagtttgattactatgaagtag

DBGET integrated database retrieval system