KEGG   Peptoclostridium difficile CD196: CD196_1555Help
Entry
CD196_1555        CDS       T00997                                 

Gene name
asnB
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cdc  Peptoclostridium difficile CD196
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CD196_1555 (asnB)
Enzymes [BR:cdc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CD196_1555 (asnB)
Peptidases [BR:cdc01002]
 Cysteine Peptidases
  Family C44
   CD196_1555 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1807307..1809181
Genome map
AA seq 624 aa AA seqDB search
MDGNISIYYKGDISKKEDIKFKIKESVNNTRLSSRIEYKDEEKTFDFERFNVIDAIYGNK
PFEKDGKVIVFNGNIYNYHEIKEELIKKGHNFTTNDDIEVLLASYIEFGKNCVHKIKGMF
NFIIYDRENESIFGARDLFGIKPLYYINKENAIIFSSEYKFLLEYMKNLNINERSLQSYF
SFQYVLPEDTMIQGIRLIPAGHYFRVENGILSLKRYNKLEFRSSTKFFYTKNHLGNRDVN
EDDIRNIVVDSIVTHMEEEKEIGTFLSGGIDSSIITTVASQINPNIKSFSAGFSVKGYSE
LEVAKKTADKLGIENIQINITQDEYIKSLPNVIYSLDDPIADPSEVGLYFLIKEAGKHVK
VALSGEGADELFGGYNIYKEYSTMKSVVNSPTYIKSILGRVSELMPNIKGRNYLYRATTP
LEKRYIGNAKVFENSEVKRFFFKYKEKNIYEYLLSNLYRDAQKNNYDYISKMQHIDVNTW
LQGDILQKISKLSTAEQVELRVPFLYKDVFDVAKNLRMEQKINKNNTKVLLREAFREIVP
EYVVQRKKLGFPTPIRVWLKDSLGDIVKETIYNSNVDEFIDKKYAIKLLDTHLKGHRDNS
RKIWTIFTFCLWHQLFIEHKNVEY
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggacggcaatatttcaatttattataaaggtgatatatctaaaaaagaagatattaaa
tttaaaataaaagaatctgtaaataatacaagactttctagtagaatagagtataaggat
gaggaaaaaacttttgattttgaaagatttaatgtaattgatgctatttatggaaataaa
ccatttgaaaaagatggaaaagttattgtttttaatggaaatatatataactatcatgaa
ataaaagaagaattaattaaaaaaggacacaattttactacaaatgatgatattgaagtc
ttattggcatcttatatagaatttggtaagaattgtgtacataagattaaaggaatgttc
aactttataatctatgatagagaaaatgaaagtatatttggagcaagagatttatttggg
ataaaaccactttattatataaataaggaaaatgcaataattttttcctcagagtataag
tttttacttgaatatatgaaaaatttaaatataaatgaaagaagcttacaaagttatttt
tcatttcaatatgtacttcctgaagatactatgatacaaggaataaggctgataccagca
ggtcactattttagggtagaaaatggtatactatctttaaagagatataataaacttgag
tttagaagtagtacaaaatttttttatactaaaaatcacttaggcaatagagatgtgaat
gaggatgatataagaaatatagtagtagattcaatagtaactcatatggaagaggagaaa
gaaattggaacatttttgtctggtggaatagattcatctattataactactgtggcttca
caaattaatccaaatataaaatctttttctgcaggctttagtgtcaaaggatatagtgaa
ttagaagtagcaaagaaaacagctgataagttaggtatagaaaatatccagattaatata
acacaagatgaatatataaaatcattaccgaatgtaatttattctttggatgaccctata
gcagacccttcagaagtaggtctttatttcttaattaaagaggcaggtaaacatgttaaa
gtagcattgtctggagaaggagcagatgaattatttggaggatataatatatataaagag
tatagtactatgaaatcagttgtcaattcacctacttatattaaaagtatattaggaaga
gtttcagaacttatgccaaacataaaaggaagaaattatctttatagagctacaacacca
ttagaaaaaagatatataggaaatgcaaaagtttttgaaaacagcgaagtaaaaagattc
ttttttaagtataaggaaaagaatatatatgaatacctgttgtctaatttgtatagagat
gcacaaaaaaataattacgattatataagtaaaatgcaacatatagatgtgaatacatgg
cttcaaggcgatatacttcaaaaaattagcaaactttctacagctgagcaggttgaactt
agagtaccatttttatataaagatgtatttgatgtagcaaaaaatttaagaatggagcaa
aaaataaataagaataatacaaaagttttacttagagaggcgtttagagaaatagtccca
gaatatgttgttcaaaggaaaaaattaggatttccaactccaataagagtttggttaaaa
gattctctaggggatattgtaaaggaaactatttataattcaaatgtagatgaatttata
gataaaaaatatgcaataaaacttttagatacgcatcttaaaggtcatagagataattcg
agaaaaatatggactatatttacattttgtctatggcatcaattatttattgagcataaa
aatgtcgagtattaa

DBGET integrated database retrieval system