KEGG   Clostridioides difficile CD196: CD196_1982Help
Entry
CD196_1982        CDS       T00997                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00260  Glycine, serine and threonine metabolism
cdc00750  Vitamin B6 metabolism
cdc01100  Metabolic pathways
cdc01110  Biosynthesis of secondary metabolites
cdc01120  Microbial metabolism in diverse environments
cdc01230  Biosynthesis of amino acids
Module
cdc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD196_1982 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CD196_1982 (thrC)
Enzymes [BR:cdc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CD196_1982 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: CBA63803
UniProt: A0A0H3N4F1
Position
2291887..2293368
Genome map
AA seq 493 aa AA seqDB search
MYYSSTRGTEEKVTASQAIIKGISSDGGLYVPSEFPNVKNELINLVNLTYSQIAFFVLSK
FLCDFTEDEIKNCIENAYDEKFDCSSIAPLNKVNDTYFLELYHGPTLAFKDMALTIMPHL
LKTSIKKDNLEKDVVILTATSGDTGKAALEGFKDIDKIKIIVFFPEDGVSPVQKLQMKTQ
TGKNTYVVGIKGNFDDAQSGVKKIFSDKKFNQKLLDNNYILSSANSINIGRLLPQVAYYF
YSYMKLVSNSEINLNDKINFVVPTGNFGNILAGYYAKQMGLPINKLICASNDNNVLYDFF
KTGVYDKNRTLKLTTSPSMDILISSNLERLLFEISNRNTDIVNKLLSDLSDKGVYKISDD
MEKNLASFYGEYSNEEEVKSTINNVFKNYNYLIDTHTAVAYNCYEKYKKETSDNTKTVIV
STASPFKFSEDVLKSIDCDFKDLDDFAIIDRLSSISKIDIPKPIKNLKNAEILHKDIYEK
DELKLAIKKFLKV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtattattcaagtacgagaggcaccgaagaaaaagtaactgcatcacaagcaataata
aaaggaatatcaagtgatggtggtctttatgttccaagtgaatttcccaatgtaaaaaat
gaacttataaatttagtaaatttaacgtattctcagatagcattttttgtacttagtaaa
tttttatgtgattttactgaagatgaaattaaaaattgtatagaaaatgcatatgatgaa
aagtttgattgtagtagtatagctccattaaataaagtaaatgatacttatttcttagaa
ctatatcacggtccaactttagcatttaaagatatggcacttactataatgcctcatctt
cttaaaacatctataaagaaagataatttagagaaagatgttgtgattcttactgctaca
tctggagatacaggcaaagctgcacttgagggatttaaagatatagataaaataaagata
attgtattcttcccagaagatggtgtaagcccagtacaaaaacttcaaatgaaaactcaa
actggaaaaaatacatatgtagttggtataaaaggaaattttgatgatgcacaatcaggt
gtaaagaagattttttctgataaaaaatttaatcaaaaactattggataataattatata
ttatcttctgcaaattcaattaatataggaagacttcttccacaagttgcatactatttt
tattcatatatgaaattagttagcaatagtgagataaatttaaatgataaaataaatttt
gttgtcccaactggtaattttggtaatattctagctggatattatgccaaacaaatgggt
cttccaataaacaaattgatatgtgcatcaaatgataataatgttctttatgatttcttt
aaaactggtgtatatgataaaaatagaacattgaaattaactacttctccttctatggat
atattaatttcaagtaatttagaacgattactgtttgaaatatcaaatagaaatactgat
attgtaaataagctgttatcagaccttagtgataaaggagtctacaaaataagtgatgat
atggaaaaaaatttagcctcattctatggagaatattcaaatgaagaagaagttaaaagc
acgataaacaatgtgtttaaaaattataattatttgatagatactcatactgctgttgca
tacaattgttatgaaaaatataaaaaagaaacttctgataacacaaaaactgttattgta
agtactgcaagtccattcaagttttctgaagatgttctaaagtctatagattgtgatttt
aaagaccttgatgactttgctataattgatagattatcaagtatttctaaaatagatatt
ccaaaacctattaaaaatcttaaaaatgcagaaatactacataaagatatttatgaaaaa
gatgaattaaaactagctataaaaaaattcttaaaggtatag

DBGET integrated database retrieval system