KEGG   Clostridioides difficile CD196: CD196_1994Help
Entry
CD196_1994        CDS       T00997                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-d-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00900  Terpenoid backbone biosynthesis
cdc01100  Metabolic pathways
cdc01110  Biosynthesis of secondary metabolites
cdc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD196_1994 (dxr)
Enzymes [BR:cdc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CD196_1994 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh Sacchrp_dh_NADP DapB_N
Motif
Other DBs
NCBI-ProteinID: CBA63826
UniProt: A0A0H3N8A3
Position
complement(2307068..2308222)
Genome map
AA seq 384 aa AA seqDB search
MKKISILGSTGSIGKQTLDVVREHRDKFEIVAISANSNIELLLEQIVEFKPKYVTVFEEN
KALKLKEMLPKNIEIEVLAGMEGLKIISSLDEVDVLLTAVVGMIGLVPTLCAIKKGIDIA
LANKETLVTAGELVMKEAEKYNVNILPVDSEHSAIFQCLNGENKKNIEKIILTASGGPFR
GKKKGELVNITKNEALKHPNWSMGRKISIDSSTLMNKGLEVIEARWLFRVEQENIDVVVH
PQSIIHSMVQYADSSIIAQLGCPDMRLPIQYALTYPDRMESSFERMNFSKFSTLTFEEPD
LETFPCLKLAYECLKMGGTYSSVLNSANEVLVSEFLEDKIGFYDIPYYIEKTLEVHSSIS
EPTLEEILETDRWSRAYVANLIKK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatatcaattttaggttctacaggctctataggtaaacaaactttggatgtg
gttagagaacatagagataagtttgagatagttgcaatatcagctaacagtaatattgaa
ttattgctagaacaaatagtagagtttaaacctaaatatgtaacagtttttgaggaaaat
aaggcattgaaattaaaagaaatgttgcctaaaaatatagaaatagaagttttagcagga
atggaaggattaaaaataatatcatcacttgatgaagtggatgtccttttaactgctgta
gtaggtatgataggattagtcccaactctttgtgctataaagaagggaatagacatagca
ttagcgaataaagaaacgttggtaactgctggtgaacttgtaatgaaagaagcagaaaaa
tacaatgtaaatattcttcctgttgatagtgaacatagtgctatatttcaatgtctaaat
ggagaaaataaaaaaaatatagaaaagataatacttacagcatctggtggtccatttaga
ggaaagaaaaagggagaacttgtaaatataactaaaaatgaagctttgaagcatccaaat
tggagtatgggaagaaaaataagtattgattcttcaacgcttatgaataaaggacttgaa
gtgatagaagctagatggttgtttagggtagaacaagaaaatatagatgtagtagttcac
ccacaaagcataattcattcaatggtgcagtatgcagatagctcaataattgctcaatta
gggtgtccagatatgagactaccaatacagtatgctcttacatatccagatagaatggaa
agtagctttgaaagaatgaatttttcaaaatttagtactttaacttttgaagaaccagat
ttagaaacttttccatgtttaaaattggcctatgagtgtttaaaaatgggaggaacttat
tcttctgttttaaattcagcaaatgaagttttagtaagtgaatttttagaggataaaatt
ggtttttatgacataccatattacatagagaagactttagaagttcatagtagcataagc
gaaccaacattagaagaaatcttagaaacagatagatggagtagagcttatgttgcaaat
ctgataaaaaaatag

DBGET integrated database retrieval system