KEGG   Clostridium difficile CD196: CD196_2185Help
Entry
CD196_2185        CDS       T00997                                 

Gene name
sucD
Definition
succinate-semialdehyde dehydrogenase
Orthology
K18119  
succinate-semialdehyde dehydrogenase [EC:1.2.1.76]
Organism
cdc  Clostridium difficile CD196
Pathway
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cdc00650]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2539650..2541041)
Genome map
AA seq 463 aa AA seqDB search
MEKAVENFEDLSKEYINGYIERARKAQREFECYTQEQVDKIVKIVGKVVYYNAEYLAKLA
VEETGMGVYEDKVAKNKSKAKVIYNNLKDKKSVGIIDIDRETGITKVAKPVGVVAAITPC
TNPIVTPMSNAMFALKGRNAIIITPHHKAIGCSTKTVEMINEELEKIGAPENLIQILDQQ
SRENTRNLISSADVVIATGGMGMVKAAYSSGKPALGVGAGNVQCIIDRDVDIKEAVPKII
AGRIFDNGIICSGEQSVIVAEEMFDKIMDEFKNNKGFIVRDKVQKEAFRNAMFVNKSMNK
DAVGQSVHTIAKIAGVEIPEDTKIIVIEADGPGEEDIIAKEKMCPVISAYKYKSFEEGVA
IAKANLNVEGKGHSVSIHSNTVKNIEYAGENIEVSRFVINQCCATSAGGSFFNGLAPTNT
LGCGSWGNNSISENLDYKHLINISRIAYYMPENEVPTDEELWG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcagtggaaaactttgaagatttaagtaaggaatacattaatggttatatt
gagagagcaagaaaagctcaaagagagtttgaatgttatactcaagaacaagtagataaa
atagtaaaaatagttggaaaagtagtgtattataatgctgaatatttagctaaacttgct
gtagaagagactggaatgggagtatatgaagataaggtagctaaaaataaaagcaaagca
aaagttatatataacaatttaaaagataaaaaatcagttggtataattgatatagataga
gaaactggaataacaaaggtagctaaaccagttggagtagtagcggcaataactccttgt
acaaatccaatcgttacacctatgagcaatgcaatgtttgcacttaagggaagaaatgca
attattatcacacctcatcataaagcaattggatgtagtacaaaaactgtagagatgatt
aatgaagaattagaaaaaataggagctccagaaaatttaatacaaatacttgaccaacaa
tcaagagaaaatacaagaaatttaatttcatcagcagatgtagtaattgccactggagga
atgggaatggtaaaagctgcgtactcaagtggaaaaccagcacttggtgtaggggcagga
aatgttcaatgtatcatagatagagatgtagacattaaagaagcagtacctaaaatcata
gcaggaagaatttttgataatggtatcatttgttcaggtgaacagtcagtaatagtagca
gaagaaatgtttgataaaataatggatgaatttaaaaataacaaaggttttatagttaga
gataaagtacaaaaagaagctttcagaaatgctatgtttgtaaataaatctatgaataaa
gatgcagtaggtcaatcagttcatacaattgcaaaaattgcaggtgttgagataccagaa
gatacaaaaataatagtaatagaagctgatggaccaggagaagaggatattattgcaaaa
gaaaaaatgtgtccagttatatctgcatacaagtataaaagttttgaagaaggtgtagct
attgcaaaagcaaatttaaatgtagaaggaaaaggacatagtgtatctatacattcaaat
acagttaaaaatatagaatatgcaggagaaaatatagaagtatcaagatttgttattaat
caatgttgtgctactagtgctggaggaagtttctttaatggtcttgcacctactaatact
ctaggttgtggttcttggggaaataacagcatctctgaaaatcttgattataagcatcta
attaatatttctagaattgcttattatatgccagaaaatgaagtccctacagatgaagaa
ctttggggataa

DBGET integrated database retrieval system