KEGG   Clostridioides difficile CD196: CD196_2305Help
Entry
CD196_2305        CDS       T00997                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00010  Glycolysis / Gluconeogenesis
cdc00052  Galactose metabolism
cdc00500  Starch and sucrose metabolism
cdc00520  Amino sugar and nucleotide sugar metabolism
cdc00521  Streptomycin biosynthesis
cdc01100  Metabolic pathways
cdc01110  Biosynthesis of secondary metabolites
cdc01120  Microbial metabolism in diverse environments
cdc01130  Biosynthesis of antibiotics
cdc01200  Carbon metabolism
Module
cdc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cdc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD196_2305 (glcK)
   00052 Galactose metabolism
    CD196_2305 (glcK)
   00500 Starch and sucrose metabolism
    CD196_2305 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    CD196_2305 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CD196_2305 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CD196_2305 (glcK)
Enzymes [BR:cdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CD196_2305 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FGGY_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: CBA64419
UniProt: A0A0H3N948
Position
complement(2671386..2672321)
Genome map
AA seq 311 aa AA seqDB search
MYYIGVDIGGTGIQAGVVDNYGKIIFRSECKTVIEKGFEGILNDIKIMIYKLLEDNKLTM
SDIKSIGFGVPGFINKEGLVTCVNLKWNKKAFNKELKRRFPDAEIHGENDATVAALGEAK
FGSMKGANVGVLYTLGTGVGGGIVINQKVFSGAHGLGSEIGHQIIGENYFNCNCGNNGCV
ETFCSATAIIKYSQKLIEEGEKSRILDLAEGNLENVNAKMVFDAYRENDLVAIKVINRFK
DYLAKTFANTINSLDPEIISIGGGISKSSDIILDGIEDLVRKFVLYKTEDIATITCATLG
SDAGIIGAAFL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtattatataggtgtagacataggaggaacaggtatacaagcaggagtagttgataac
tatgggaagataatttttaggtcagagtgtaaaacagtaattgaaaaaggctttgaagga
atacttaatgacataaaaataatgatttataagttgttggaagataataaacttactatg
agtgacataaaatctattggatttggtgttccaggttttataaataaagaaggattagta
acttgtgtaaatttaaaatggaataaaaaagcttttaataaagagttaaaaagaagattt
ccagatgctgaaattcatggagaaaatgatgcaacagtagcagcacttggagaagcaaag
tttggaagtatgaaaggtgctaatgttggagtattatatactttaggaactggtgtaggt
ggaggaatagtaattaatcaaaaagtcttttctggagcacatggattgggttcagaaata
ggtcatcaaattataggagaaaactattttaattgtaattgtggaaataatggttgtgta
gaaactttttgttcagcaactgcaattataaagtattctcaaaaactgatagaagaagga
gaaaagagtaggattttagatttggcagagggaaatttagaaaatgtaaatgcaaagatg
gtgtttgatgcatatagagaaaatgatttagtggcaattaaagtaataaatagatttaaa
gattatttagcaaaaacttttgcaaacacaataaattctttagacccagaaattatatct
ataggaggaggcatttctaaatctagcgatataatacttgatggaatagaagatttggta
agaaaatttgtattatacaaaacagaagatatagctacaattacatgtgcaactttaggt
tcagacgcaggaattataggagcagcttttttataa

DBGET integrated database retrieval system