KEGG   Clostridium difficile CD196: CD196_2386Help
Entry
CD196_2386        CDS       T00997                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cdc  Clostridium difficile CD196
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cdc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2772937..2773986)
Genome map
AA seq 349 aa AA seqDB search
MNNIIWKITLFGGINIKRIGIIIMFFLSIAFIGFYLAIRGNSDTVKMQRGINIGNALESP
KDFPWDVKMSNKFFDDIKDAGFDTVRIPVRFSDYTSDSDNFKIDEEFFKKIDKYVDYALD
KDLIVVLDLHHFEEIMKEPRVHKEEFLKIWQQIANRYQKYDKKLVFELLNEPKENLSSQL
LNEYIEEAIKIIRKTNPKRTIIVGPYNFYQIDYLNELNVPKDSNIVVSFHYYEPNDFAFQ
GNIYHNGFEHLSNITWEGTNEQMDYLKKRFDIVENWANKNKVKIFLGEFGVTKEAPEASR
RAWIKAVREEAEKRNFSWAYWELASGFGIYNQIEGTWDRDILSALIEKR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttgaataatattatatggaagataacattgtttggggggattaatataaaaagaataggt
attattataatgttttttttaagtatagcttttattggattttatcttgcaataagaggt
aacagtgatacagttaagatgcaacgagggataaatataggtaatgcactagaatcacct
aaggattttccgtgggatgtaaaaatgtcaaataagttttttgatgatataaaagatgca
ggttttgacacagtacgtataccagtaaggttttctgattatacgtcagattctgataat
tttaaaattgatgaagaattttttaaaaagattgataaatatgtagattatgcattggat
aaagacttaatagttgtgttggatttacatcattttgaagaaattatgaaagaaccaaga
gttcataaagaagagtttttaaaaatatggcaacagatagctaataggtatcaaaaatat
gataaaaaattggtatttgaattattaaatgaacctaaagaaaatttatcttcacaatta
ctaaacgaatacattgaagaagcaataaagataattagaaaaactaaccctaaaagaact
attatagtgggaccatataatttctatcaaattgattatttgaatgaattaaatgttcca
aaagattctaatatagtagtttcttttcactattacgaaccaaatgattttgcatttcaa
ggaaacatttatcataatggatttgagcacttgagcaatattacttgggaaggaacaaat
gaacaaatggattatttaaaaaaaaggtttgatattgtagaaaattgggcaaataaaaat
aaggtaaaaatattcttgggtgaatttggagtaacaaaagaagcaccagaagcttcaaga
agagcttggataaaagctgtaagagaagaagctgaaaaacgaaacttttcatgggcttat
tgggagcttgcttctggatttggtatatacaatcaaattgaagggacttgggatagagac
atattaagtgcattaatagaaaagaggtga

DBGET integrated database retrieval system