KEGG   Clostridioides difficile CD196: CD196_2517Help
Entry
CD196_2517        CDS       T00997                                 

Gene name
thlA2
Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdc  Clostridioides difficile CD196
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CD196_2517 (thlA2)
   00630 Glyoxylate and dicarboxylate metabolism
    CD196_2517 (thlA2)
   00640 Propanoate metabolism
    CD196_2517 (thlA2)
   00650 Butanoate metabolism
    CD196_2517 (thlA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CD196_2517 (thlA2)
   00072 Synthesis and degradation of ketone bodies
    CD196_2517 (thlA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CD196_2517 (thlA2)
   00310 Lysine degradation
    CD196_2517 (thlA2)
   00380 Tryptophan metabolism
    CD196_2517 (thlA2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD196_2517 (thlA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CD196_2517 (thlA2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CD196_2517 (thlA2)
Enzymes [BR:cdc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CD196_2517 (thlA2)
Exosome [BR:cdc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CD196_2517 (thlA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2925505..2926683
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVSAVRTPIGSFGGVFKNTSAVQLGTIAVKEAISRVGLNLSEIDEVIIGNVLQTG
LGQNVARQIAINSGIPNSVPSYTVNKLCGSGLKSVQLAAQSITSGENDVVIAGGTENMSQ
APYIVPTARFGSKMGDITMVDSMLTDGLIDAFNQYHMGITAENIATKFEFTREMQDKLAL
ESQNKAENAIKNNRFKEEIVPVDVLIRRGKIETIDKDEYPKLGMTFEGLAKLKPAFKKDG
TVTAGNASGINDGAAMLILMSQQKADELGIRPLAKIKSYASAGVEPEVMGTGPIPATRKA
LKKAGLSINDIDLIEANEAFAAQALAVKNELQIDSSKLNVNGGAIALGHPIGASGARILV
TLIYEMQKRKVETGLATLCIGGGQGISMVVSR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtagtaatcgtatcagcagtcagaacacctataggaagttttggaggtgta
tttaaaaatacttcagctgttcaacttggaactatcgctgttaaagaagcgatatcacgt
gtaggacttaatttatctgaaatagatgaagtaataattggaaatgttcttcaaacaggg
cttggacagaatgttgctaggcaaattgctataaattcaggtataccaaattctgttcca
agctacacagtaaataaattatgtggttcagggcttaaaagtgttcagctagctgcccaa
tcaatcacatctggtgaaaatgatgtggtaattgcaggtggtactgaaaatatgagccaa
gctccttatatcgttccaactgctcgctttggtagtaaaatgggtgacataaccatggta
gatagtatgctaacagatggccttattgatgctttcaatcagtatcatatgggaataact
gcagaaaatattgcaactaaatttgaatttactagagaaatgcaagataaattggcatta
gaaagtcaaaataaggctgagaatgctataaaaaacaaccgctttaaagaagaaatcgtt
ccagtagatgttttaatacgtcgaggaaaaatagaaactattgataaagatgaatatcct
aaattaggcatgacatttgaaggtttagctaaacttaaacctgcattcaaaaaagatggt
actgtaacagctggaaatgcctcaggtattaatgatggtgcggctatgttaatactaatg
agccaacaaaaagcagacgaactaggtattagaccacttgctaaaataaaatcctatgct
tcagctggtgttgaacctgaagtcatgggtactggtccaatccctgcaactagaaaagca
ctgaaaaaagctggacttagcatcaatgatatagacttaatagaagcaaacgaagcgttt
gctgcccaagcattagctgttaaaaatgaacttcaaatagattcatcaaagttaaatgtt
aatggtggtgcaatagcattaggacatccaataggagcaagtggagctagaatacttgtt
accttaatttatgaaatgcaaaaacgtaaagttgaaactggacttgcaacactttgtatt
ggtggtggtcaaggaatatcaatggtggtttcacgatag

DBGET integrated database retrieval system