KEGG   Clostridioides difficile CD196: CD196_2520Help
Entry
CD196_2520        CDS       T00997                                 

Gene name
bdhA
Definition
(GenBank) D-beta-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00072  Synthesis and degradation of ketone bodies
cdc00650  Butanoate metabolism
cdc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CD196_2520 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CD196_2520 (bdhA)
Enzymes [BR:cdc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     CD196_2520 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase 3HCDH_N 3Beta_HSD Methyltransf_31 GDP_Man_Dehyd Ldh_1_N Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: CBA64831
UniProt: A0A0H3N5Z1
Position
2928112..2928894
Genome map
AA seq 260 aa AA seqDB search
MKMVKDKVVFVTGAASGIGKQIAESFLKNGAKVMFSDINQEALNNTITELQKKGYDCMSV
KCDVTKEEEINHAIDKTVEKYGRLDILINNAGLQHVSMIEDFPTDKFEFMIKIMLTAPFI
ATKKAFPIMKKQGFGRIINMASINGVIGFAGKAAYNSAKHGLIGLTKVAALEAADSGITV
NALCPGYVDTPLVRGQFNDLSKTRNIPLENVLEEVLYPLVPQKRLLDVQEIADYAMFLAS
DNAKGITGQACLLDGGYTAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggttaaagataaagttgtattcgtaacaggagctgcaagtggaataggtaaa
caaatagctgaatcgttcttaaaaaatggtgctaaagtaatgttctctgatataaatcaa
gaagctttaaataataccataacagagttacaaaaaaaaggttatgattgcatgagtgta
aagtgtgatgtaactaaggaagaagaaattaaccacgctatagataaaactgttgaaaag
tatggcagattagatatattaataaacaatgctggacttcaacatgtttctatgatagaa
gatttcccaactgataaatttgaatttatgataaaaataatgctgacagcaccttttata
gctactaaaaaagcatttcctataatgaaaaaacaaggctttggtcgtataataaatatg
gcctcaatcaatggtgtaataggatttgctggaaaggctgcttataactcagcaaaacat
ggacttattggactaacaaaagttgctgctcttgaagctgccgattctggtataacagtt
aatgctttatgccctggatatgtagatactccacttgtcagaggtcagtttaatgacctt
tcaaaaactcgtaatataccattagaaaatgtcttagaggaagttttgtacccacttgta
ccacaaaaacgcctattagatgttcaagaaattgccgactatgctatgttcctagcaagt
gataatgctaagggtattacaggacaagcttgcttactagatggaggatatactgcacaa
tag

DBGET integrated database retrieval system