KEGG   Clostridium difficile CD196: CD196_2648Help
Entry
CD196_2648        CDS       T00997                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cdc  Clostridium difficile CD196
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cdc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3105964..3106566)
Genome map
AA seq 200 aa AA seqDB search
MYSYIKGTVEEIYIDSIVVENNGIGYKINVSSNTIMNLQVGEATKIYTKLIVREDDMSLC
GFVSREELKMFELLTSVSKIGPKVALSILSFASSAQLGAYILSEDIGKLSKAPGVGKKTA
ERIVLELKDKVDKNNIEFEPTLLSQKPTLISQDESVDALVALGYTLSESKEAVQKCKKDG
MNTEAIIKKALTYIMSKSLK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtatagttatataaaaggtacagtagaagaaatttatatagacagtatagttgttgaa
aataatgggataggatataaaataaatgtatcatccaatacaataatgaatttacaagtg
ggagaagccacaaaaatatatactaaattaattgtaagagaagatgatatgagtctttgt
ggttttgtaagtagggaagaacttaagatgtttgaattactaacatctgtatctaaaata
ggacctaaggtggcgctttcaatactatcatttgcatcatcagcacagttaggagcatat
attttaagtgaagacattggaaaattatccaaagctcctggtgttggtaaaaagacagca
gaaagaatcgtcttagagcttaaggataaggtagacaaaaataacatagagtttgaacca
acgttattatcacaaaaacctaccttgatatcacaagatgagtctgtagatgcacttgta
gctttaggctatactttgtcggaatcaaaagaggcagttcaaaaatgtaaaaaagatggt
atgaatacagaagctattataaagaaagctcttacatatataatgagtaaatccttgaaa
tag

DBGET integrated database retrieval system