KEGG   Peptoclostridium difficile CD196: CD196_2871Help
Entry
CD196_2871        CDS       T00997                                 

Gene name
ascB
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cdc  Peptoclostridium difficile CD196
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD196_2871 (ascB)
Enzymes [BR:cdc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CD196_2871 (ascB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3376943..3378400)
Genome map
AA seq 485 aa AA seqDB search
MIKLSKFPKDFLWGGAVAANQLEGAWNEGGKGWCLADVHMYDKDRDISKHYESDMTVDKI
KFAMKDNNGYYPKRNGIDFYHTYKEDLKLLKELGLKCFRFSINWARIFPNGDDLEPNEEG
LKFYDNLINEVIDNGMEPIVTLLHYETPLNLVLKYKGWSNRKVVDFFVRYAELILNRYKD
KVKYWIVINQINLMYHESFNSVAFCVDQVDDVEEAKYQAIHHQFMATALTKKLGKEINSD
MMIGMMMADCTSYPEDCDPENVVFALKRNRIQYFFTDVSFRGEYPAYIKRFFKENNINIV
MEEGDDKVLKENTMDFLALSYYYSTTVSASKNTMNPIDNVKNQYLKANPWGWAIDPKGLY
NTLSQYYDRYQKPIMIAENGFGMHDKFEDGKVHDSYRIDYLGKHIEQIGEAIADGTEILA
YCMWSPIDIVSCSSQEMEKRYGFIYVDIDNNGNGSKERYKKDSFYWYKNVIRTNGEELKE
KVDSF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaattgagtaagtttcctaaagattttttgtggggtggagctgtagcagctaat
caattagaaggtgcttggaatgaaggtggcaaagggtggtgcttagctgatgtacatatg
tatgataaagatagagatatatctaaacattacgagtctgatatgactgtagataaaata
aagtttgctatgaaagataataatgggtattatcctaagcgtaatggaatagacttttat
catacatacaaagaagatttaaagcttttgaaagaactagggttaaagtgttttagattt
tcaataaattgggctagaatatttccaaatggagatgatttagagcctaatgaagaggga
ttaaagttttatgataatcttataaatgaagtaatagataatggtatggaacctattgta
acactactccattatgagactcctttgaatttagtattaaaatataaaggatggtctaat
agaaaagtagtggatttctttgttagatatgcagaattaatattaaatagatacaaagat
aaagttaaatattggatagttataaaccaaataaatttaatgtatcatgaatcatttaat
tcagttgcattttgtgtagaccaggtagatgatgtagaagaggccaaatatcaagctatt
catcatcaattcatggctacagctttaactaagaagcttggaaaagaaataaattcagat
atgatgatagggatgatgatggcagattgtacatcttatccagaagattgcgaccctgaa
aatgtagtatttgctttaaaaagaaatagaatacaatatttttttactgatgtaagtttt
agaggggagtatccagcttatattaagagattcttcaaagaaaataacataaatatagtt
atggaagaaggtgatgataaagtgttaaaagagaatactatggattttctagctctatca
tactattactctacaacagtatcagcaagtaaaaataccatgaatccaattgataatgta
aaaaatcaatacttaaaagcaaatccttgggggtgggcaattgaccctaaaggattatac
aatactttatctcaatattatgatagatatcaaaagccaataatgatagctgaaaatgga
tttggaatgcatgataaatttgaagatggaaaagttcatgatagttatagaatagattat
ttaggaaaacatatagaacaaataggtgaagctatagctgatggaaccgaaatattagct
tattgtatgtggtcgccaatagatatagtaagttgttcatctcaagaaatggaaaaaaga
tatggatttatatatgtagatatagataacaatggaaatggaagcaaagaacgttacaaa
aaagatagtttttattggtataaaaatgtaataagaactaatggagaagaattaaaagaa
aaagtagatagtttttaa

DBGET integrated database retrieval system