KEGG   Clostridioides difficile CD196: CD196_2901Help
Entry
CD196_2901        CDS       T00997                                 

Definition
(GenBank) putative phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00010  Glycolysis / Gluconeogenesis
cdc00030  Pentose phosphate pathway
cdc00051  Fructose and mannose metabolism
cdc00052  Galactose metabolism
cdc00680  Methane metabolism
cdc01100  Metabolic pathways
cdc01110  Biosynthesis of secondary metabolites
cdc01120  Microbial metabolism in diverse environments
cdc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD196_2901
   00030 Pentose phosphate pathway
    CD196_2901
   00051 Fructose and mannose metabolism
    CD196_2901
   00052 Galactose metabolism
    CD196_2901
  Energy metabolism
   00680 Methane metabolism
    CD196_2901
Enzymes [BR:cdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CD196_2901
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CD196_2901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CBA65784
UniProt: A0A0H3NFD7
Position
3418279..3419511
Genome map
AA seq 410 aa AA seqDB search
MKGRCKMRNCIIAQSGGPTAVINASAVGIYEKNLETKYFDKVYFGINGIEGILNKNIIDS
DSLNKDNVLNLKQTPSSGLGSCRYKLADYKINSYDYDRVINILDEYEIDTLFYIGGNDSM
DTVMKFSQYCKNTTCKIKFIGIPKTIDNDLLGTDNCPGFGSAAKLISTLIMETYLDFSIY
KNNGIFIVETMGRDTGWLAASSSLARLNDTPLVDLIYLPEIDFYEDKFIEDVRKIFKEKN
KAYIVASEGIRDKYGNFICEQKTSAHDKFGHSQLGGVSNYLKNLIVSSSITTRVKTLELG
VIQRCAMHLASDTDLKQAAEVGAYGIELSKKGYTGVMAIINRTCNNPYKYEVSHTDISKI
ANKTKYFPKEWINEECNYITDEALNYLYPLIQGKPDIKYKNGLPYFSIIY
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggagatgtaaaatgagaaactgtattattgcccaatctggaggccctacagct
gttatcaatgcttctgcagttggtatttatgaaaaaaatttagaaactaaatactttgat
aaagtatattttggtatcaatgggattgaaggtatattaaacaaaaatataatagattca
gactccttaaacaaagataatgtattaaatttaaagcaaacaccttcgtctggtcttggt
tcttgtagatacaaactggctgattataaaataaattcttatgattatgatagagttata
aatatactagatgaatatgaaatagatacattattttatataggcggaaatgattctatg
gacacagtgatgaaattttctcaatactgcaaaaacactacttgtaaaataaaatttata
gggattcctaaaacaatagataatgatttattaggaactgacaactgtcctggatttggt
tctgctgcaaagcttatttctacactaataatggaaacatacttagatttttctatatac
aaaaataatggtatatttatagtagaaaccatgggtagagatactggatggttagcagct
tcttcttcactagctagacttaatgatactccacttgttgatttaatataccttccagaa
attgatttctatgaagataagtttatagaagatgttagaaaaatatttaaagaaaaaaat
aaggcttatatagttgcatcagaaggtataagggataaatacgggaactttatatgcgaa
caaaaaacttctgctcatgataaatttggtcattcccaattaggtggagtaagcaactat
ctaaagaatcttatagtatcatcatcaattacaacaagagtaaaaaccttagaacttggt
gtaatacaaagatgtgctatgcatttagcttcagatactgatttaaaacaagcagctgaa
gttggtgcatatgggatagaactatctaaaaaaggatatacaggagttatggctatcatt
aatagaacatgcaataatccttataagtatgaagttagtcatactgatatttctaaaata
gctaacaagacaaaatattttcctaaagagtggataaatgaagaatgtaattatataact
gatgaagccctaaattatctatatccacttattcaaggtaaaccagatatcaaatataaa
aatggactaccttatttttcaattatttactag

DBGET integrated database retrieval system