KEGG   Clostridium difficile CD196: CD196_2907Help
Entry
CD196_2907        CDS       T00997                                 

Gene name
bglA2
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cdc  Clostridium difficile CD196
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD196_2907 (bglA2)
Enzymes [BR:cdc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CD196_2907 (bglA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3428501..3429955)
Genome map
AA seq 484 aa AA seqDB search
MNIKDTFFWGGSIAAHQCEGSWDSDNKGPAIMDFVTKGSYETPRVITDKIEEKLDYPSHN
GIDFYNRYKEDIALFKEMGFSALRISIDWSRIFPNGDDENPNELGIKYYEGLIDTLIENN
IEPIVTLYHFELPMNLVHKYGSWNNRKLMDLYLKYSETVIRRFDDKVKYWITFNEMNHID
PQTEHSDIFTYMIAGIKYSEIENKVQTLANVGYNMTLAGVKVAKLAREINPNNKVGCVFG
LNPIYPYNCNPSNVLNAFLDNDRDYYQIDAMCNGKFPQYKLKEYEKNNITIEVTDEDKKA
FKEGKLDFIGLNYYFSSVSTPKENLSGDKSLFGGIQNPYLEQSKWGWAIDPIGLRFTLNY
IYRKYQLPILITENGLGAYDKIEEDGTINDDYRIEYLSKHLSQMKSAIEEDNVECFGYLM
WGPIDLVSATTGQMSKRYGFIYVDLDDEGKGSFKRYKKKSFDWYKEVIKSNGEVLDFSTD
IVVG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaagatacatttttctggggaggaagtattgcagcccatcaatgtgaaggt
tcatgggatagtgataacaaaggacctgcaattatggattttgtaactaagggctcttat
gaaacgccaagagtaattactgataaaatagaagaaaaattggattatccatctcataat
ggaatagatttttataatagatataaagaagatatagctttatttaaagaaatgggattt
agtgcattaagaatatctatagattggtcaagaatttttccaaatggagatgatgaaaat
cctaatgaattagggattaaatactatgaaggtctgatagatacattaatagaaaataat
atagaacctattgtaacactatatcattttgaattacctatgaatttagtacataaatat
ggttcatggaataacagaaaacttatggatttgtatttaaagtacagtgagactgtaata
agaaggtttgatgataaagtaaagtactggattacatttaatgagatgaaccatattgac
cctcaaacagagcactcggatatttttacttatatgatagcaggtattaagtatagtgaa
atagaaaataaggttcaaacattggcaaatgtagggtataatatgactttggcgggtgta
aaggttgcaaagttggctagagaaatcaatcccaacaataaagttggatgtgtatttgga
ctaaatccaatttatccatacaattgtaatcctagtaatgtgttaaatgcatttttagat
aatgatcgtgattattatcaaattgatgcaatgtgcaatgggaagtttccccaatataaa
ttaaaagaatatgaaaaaaataatataactattgaagtgactgatgaagacaaaaaagca
tttaaagaaggtaagttagattttataggtcttaattattatttttcaagtgtatctact
ccaaaagaaaatttatcaggtgataaatctttatttggtgggattcaaaatccatatttg
gaacaaagtaagtggggatgggcaatagaccctataggtttaagatttaccttgaactat
atttacagaaagtatcaattacctatcttaattacagaaaatggtttaggggcatatgat
aaaatcgaagaagatggaactataaatgatgattatagaattgaatatttaagtaagcat
ctatctcaaatgaagtctgcaattgaagaggataatgttgaatgttttggatatttgatg
tggggaccaattgatttagtcagtgcaactacaggtcagatgagtaagagatatggattt
atatatgttgacttagatgatgaaggcaaaggaagttttaagagatataagaaaaaatca
tttgattggtacaaagaagtaataaaatctaatggagaagttttagatttttctacggat
atagtagtagggtag

DBGET integrated database retrieval system