KEGG   Clostridium difficile CD196: CD196_2921Help
Entry
CD196_2921        CDS       T00997                                 

Gene name
ascB2
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cdc  Clostridium difficile CD196
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cdc00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3448600..3450027)
Genome map
AA seq 475 aa AA seqDB search
MSFKDDFLWGGATAANQCEGGYNEDERGLANVDVCPTGKDRTAVITGKLKMFDFDDEHYY
PAKTGIDMYHNYKEDIKLFAEMGFKVYRMSIAWSRIFPKGDEETPNEKGLQFYENIFKEC
KKYKIEPLVTITHFDCPMHLVKKYGAWRNRKMIGFYEKLCNVIFRRYRGLVKYWLTFNEI
NMILHAPFMGAGICFEEGEDVEKIKYQAAHHELVASAIATKIAHEVDSNNLVGCMFAAGS
VYPYSCNPNDVWEATKLDRENYFFVDVQSKGKYPNYALKYMEQKGITPEMEPGDIELLNK
YTVDFISFSYYNSRCVRTDENADDMAEGNIFTSAKNPYLSYSQWGWPIDPLGLRITLNHV
YDRYEKPLFIVENGLGAKDIADENGYVEDDYRINYLREHIKAMHDAVSIDGVDLLGYTTW
APIDLVSAGTGEMEKRYGFIYVDRDNSGNGSLRRMKKKSFEWYKKVIASNGEDLY
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaaggatgattttttatggggaggagctactgcagccaatcaatgtgaaggt
ggatacaatgaagacgaaagaggattggcaaatgtagatgtatgtccaacaggaaaagat
agaacagcagttattacagggaaactaaaaatgtttgattttgatgatgagcattattat
ccagctaaaactggtattgatatgtatcataattataaagaagatataaagttatttgct
gaaatgggatttaaagtatatagaatgagcattgcatggagtcgaatatttccaaaaggt
gatgaagaaacaccaaatgaaaagggacttcaattttatgaaaatatatttaaggagtgt
aaaaaatataaaatagagcctttagtcactattacacactttgattgtccaatgcattta
gttaaaaagtatggtgcatggcgtaatcgaaaaatgataggtttctatgagaaattatgc
aatgttatctttagaagatatagaggattagtgaagtactggctaacctttaatgaaata
aatatgattttacatgctccatttatgggtgctggtatttgctttgaagaaggtgaagat
gttgaaaagataaaatatcaagctgctcatcatgagcttgtagctagtgcaattgcaact
aaaatagcacatgaagttgattcaaataacttagttggatgtatgtttgcagctggaagt
gtatatccttatagttgtaatcctaatgatgtatgggaagctacaaagttagatagagaa
aattacttctttgtggatgtacaatctaaaggtaaatatcctaactatgcgttaaagtat
atggagcaaaaaggtattacaccagaaatggaacctggtgatattgaattattgaataaa
tatacagtagattttatttcattttcatattacaatagccgttgtgttagaactgatgaa
aatgcagatgatatggctgaaggaaacatatttacatctgctaaaaatccatatctttca
tacagtcaatggggatggccaattgacccattaggtttgagaattacactaaatcatgta
tatgatagatatgaaaagccactatttattgtagaaaatggattaggtgctaaagatata
gctgatgaaaatggttatgtagaagatgattacagaattaattatctaagagaacatata
aaagctatgcatgatgcagtttctatagatggggtcgatttattaggttatactacatgg
gcacctattgatttagtaagtgctggtacaggtgaaatggaaaagcgttatggatttata
tatgtagatagagataatagtggtaatggaagtctaagaagaatgaaaaagaaaagtttt
gaatggtataagaaagtaattgcttcaaatggtgaagatttatattaa

DBGET integrated database retrieval system