KEGG   Clostridium difficile CD196: CD196_3196Help
Entry
CD196_3196        CDS       T00997                                 

Gene name
hemD
Definition
porphyrin biosynthesis protein
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cdc  Clostridium difficile CD196
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cdc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3795722..3797221)
Genome map
AA seq 499 aa AA seqDB search
MKGKVYLVGAGPGDYKLMTLKGLECIRKSDVIVYDRLANSSYLREAKPDCELIYVGKASS
NHILPQEDINRIIAEKAKEGKIVTRLKGGDPYVFGRGGEEAETLVDEDIEFEVVPGITSA
IGGLCYAGIPITHRDHASSFHVITGHLKGDDSGELNWNALANNKGTLVFLMGISNLEKIS
ENLMKEGKDKDTPVALISWATRYNQRVVTSTLENVYETAIKEEVKPPTLIVVGSVVGLRE
KLNFFESKPLFGKSIAVTRSRNQNSVLVEKIMDLGGNPIEIPTIKVEKIQNNINLENEIK
NINKYNYLILTSKNAVEIFFEKIYEMNFDLRILSNLKVCAIGSATSNELKKRGIIADIVP
KKFVAESLYEELAPILNDNDNILIPRAENARDYLVDKLKAICEVTEVHIYRTVIDEDKKG
EILDILNSNDIDYITFTSSSTVNNLVEIIGKENIKILEKIKTLSIGPITTETINSLGIKL
YKESATSTIDSLVDLIIKN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtaaggtttacttagtaggggcaggaccaggtgattataaactcatgacttta
aaaggtttagagtgtataagaaaatcggatgtaatagtatatgatagattagcaaatagt
agttatttaagagaagctaagcctgattgtgaacttatatatgtaggcaaggcatcaagt
aatcatattttgccacaagaagatataaatagaattatagcagaaaaagctaaagaagga
aaaattgtaactcgtcttaaaggaggagacccttatgtatttggcagagggggagaagaa
gcagagactttagtagatgaagatatagaatttgaagtagttccaggtataacttctgct
ataggaggtttatgttatgcgggtattcctataacacatagagaccatgcttcgtcattt
catgtaataacaggtcatttgaagggtgatgatagtggagaattaaactggaatgctctt
gcaaataacaaaggtactcttgtgtttttgatgggaatttcaaacctagagaaaataagt
gaaaacttaatgaaagaaggaaaagataaggatacacctgttgctcttataagttgggca
actagatataatcaaagagttgttacatctacacttgagaatgtttatgaaactgctatt
aaagaagaagtaaaaccgccaactcttatagtagttgggagtgttgtaggacttagagaa
aagttgaacttctttgaaagtaagcctttatttggaaaaagtattgctgtaactaggtct
agaaatcaaaatagtgtattggtagaaaaaataatggatttaggtggaaatcctatagaa
atacctactattaaggtagaaaaaatacaaaataatattaacttagaaaatgaaataaaa
aatataaataagtataattatttaatactaactagtaaaaatgccgtagaaatcttcttt
gaaaagatatatgaaatgaattttgatttaaggatattatctaatttaaaggtatgtgct
ataggttctgctacatcaaatgagttgaaaaaaagaggaattatagcggatatagtacca
aaaaaatttgtagcagagtcactgtatgaagagttagctcctattttaaatgataacgat
aatatacttatacctagagcagaaaatgctagagattatctggttgacaaacttaaggct
atttgtgaagtaacagaagtacatatatatagaacagtaatagatgaggataaaaaaggt
gagatattagatattttaaattctaatgatatagattatataacatttactagttcctca
acagtaaataatcttgttgaaattataggaaaagaaaatattaaaatattagaaaaaata
aaaacactatctataggtcctataactacagagacaataaatagtttgggaataaaattg
tacaaagaatctgctacatctactatagattcgttagtagatttaattataaaaaattaa

DBGET integrated database retrieval system