KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_0179Help
Entry
CDCE8392_0179     CDS       T01700                                 

Gene name
tox
Definition
diphtheria toxin precursor (EC:2.4.2.36)
Orthology
K00776  
NAD-diphthamide ADP-ribosyltransferase [EC:2.4.2.36]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
173590..175272
Genome map
AA seq 560 aa AA seqDB search
MSRKLFASILIGALLGIGAPPSAHAGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGI
QKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALK
VDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQ
AKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDVIRDKTKT
KIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAG
ANYAAWAVNVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIAL
SSLMVAQAIPLVGELVDIGFAAYNFVESIINLFQVVHNSYNRPAYSPGHKTQPFLHDGYA
VSWNTVEDSIIRTGFQGESGHDIKITAENTPLPIAGVLLPTIPGKLDVNKSKTHISVNGR
KIRMRCRAIDGDVTFCRPKSPVYVGNGVHANLHVAFHRSSSEKIHSNEISSDSIGVLGYQ
KTVDHTKVNSKLSLFFEIKS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagaaaactgtttgcgtcaatcttaataggggcgctactggggataggggcccca
ccttcagcccatgcaggcgctgatgatgttgttgattcttctaaatcttttgtgatggaa
aacttttcttcgtaccacgggactaaacctggttatgtagattccattcaaaaaggtata
caaaagccaaaatctggtacacaaggaaattatgacgatgattggaaagggttttatagt
accgacaataaatacgacgctgcgggatactctgtagataatgaaaacccgctctctgga
aaagctggaggcgtggtcaaagtgacgtatccaggactgacgaaggttctcgcactaaaa
gtggataatgccgaaactattaagaaagagttaggtttaagtctcactgaaccgttgatg
gagcaagtcggaacggaagagtttatcaaaaggttcggtgatggtgcttcgcgtgtagtg
ctcagccttcccttcgctgaggggagttctagcgttgaatatattaataactgggaacag
gcgaaagcgttaagcgtagaacttgagattaattttgaaacccgtggaaaacgtggccaa
gatgcgatgtatgagtatatggctcaagcctgtgcaggaaatcgtgtcaggcgatcagta
ggtagctcattgtcatgcataaatcttgattgggatgtcataagggataaaactaagaca
aagatagagtctttgaaagagcatggccctatcaaaaataaaatgagcgaaagtcccaat
aaaacagtatctgaggaaaaagctaaacaatacctagaagaatttcatcaaacggcatta
gagcatcctgaattgtcagaacttaaaaccgttactgggaccaatcctgtattcgctggg
gctaactatgcggcgtgggcagtaaacgttgcgcaagttatcgatagcgaaacagctgat
aatttggaaaagacaactgctgctctttcgatacttcctggtatcggcagcgtaatgggc
attgcagacggtgccgttcaccacaatacagaagagatagtggcacaatcaatagcttta
tcgtctttaatggttgctcaagctattccattggtaggagagctagttgatattggtttc
gctgcatataattttgtagagagtattatcaatttatttcaagtagttcataattcgtat
aatcgtcccgcgtattctccggggcataaaacgcaaccatttcttcatgacgggtatgct
gtcagttggaacactgttgaagattcgataatccgaactggttttcaaggggagagtggg
cacgacataaaaattactgctgaaaataccccgcttccaatcgcgggtgtcctactaccg
actattcctggaaagctggacgttaataagtccaagactcatatttccgtaaatggtcgg
aaaataaggatgcgttgcagagctatagacggtgatgtaactttttgtcgccctaaatct
cctgtttatgttggtaatggtgtgcatgcgaatcttcacgtggcatttcacagaagcagc
tcggagaaaattcattctaatgaaatttcgtcggattccataggcgttcttgggtaccag
aaaacagtagatcacaccaaggttaattctaagctatcgctattttttgaaatcaaaagc
tga

DBGET integrated database retrieval system