KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_0312Help
Entry
CDCE8392_0312     CDS       T01700                                 

Gene name
rmlD
Definition
dTDP-4-dehydrorhamnose reductase
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:cdd00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:cdd00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(307105..308451)
Genome map
AA seq 448 aa AA seqDB search
MQVRPTAIAGVVIVDLDVHGDNRGWFKENWQREKMVAAGLPDFQPVQNNISFNAERGVTR
GLHAEPWDKFVSVAHGEVFGAWCDLREGSDTFGEVVTCTITPYTAVFVPRGVANGFQALV
DNTSYTYLVNDHWSPDATYTAVNLGMIDWPLPPTEISDKDRCHPQLAEATPMPPRRILIT
GAHGQLGRALAELLPDAELCAHADFDVVNPPQRPWRQYEAIINCAAYNNVDAAEDDRARA
WEVNAVAPARLAQIATENNLTLVHVSTDFIFDGTTLVHEETEAPSPLSVYGASKAAGDIA
AAVTPKHYVVRTSWVFGQGGNFVETMRLLAQRGIRPNVISDQRGRPTHAADLAAGIVHLL
RSGADYGVYNLSNSGDVVGRDDLARAVFEHCGVSGAAVTSVTTAEYEALTGPLAKRPAES
TFNLGKIVATGFQPRPWRDAVRDYLGTK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttcgccccactgctattgccggtgttgttattgtcgacctcgacgttcatggc
gataatcgtggatggttcaaggagaactggcagcgggaaaagatggtggcggcgggcttg
ccggatttccagccggtgcaaaacaatatttcttttaacgctgagcggggcgtgacacgt
ggtttgcacgccgagccgtgggataagttcgtgtcggtggctcatggcgaagtgtttggt
gcgtggtgcgacctgcgcgagggttctgacaccttcggcgaggtagttacctgcaccatt
accccttatactgcggtgtttgtgccgcgtggggtggccaatggttttcaggcgctggta
gacaacacgagttacacctacttggtcaatgatcattggtcgccggacgctacgtatact
gcggtgaatctgggcatgattgattggccgcttcctcccacggagatttcggataaggat
cgttgccacccccagcttgccgaggccaccccgatgccaccgcgtcgcattctcatcacc
ggcgcccatggccagttggggcgtgcgctagccgagttgttgccggatgccgagttgtgt
gcgcatgcggatttcgatgtggttaacccaccgcagcgcccgtggcgccagtatgaggcg
attattaactgtgcggcctataacaatgtggatgcggcagaagatgatcgtgcccgcgct
tgggaggtcaatgctgttgccccagcaaggctggcccagattgctacggagaataatctg
acgttggtgcatgtgtcgacggatttcattttcgacggcaccacgttagtgcatgaggag
acggaagcgccgtcgccgttgtcggtgtatggggcgtcgaaggcggcgggtgatattgcg
gctgctgtgacaccgaaacactatgtggtgcgtacgtcgtgggtctttggccaaggtggc
aactttgtggaaactatgcgcttgctggcgcagcgtgggattcgccccaatgtgattagc
gaccagcgtggtcgtccaacccatgcggctgatctggcggcgggtattgtgcatttgctg
cgcagcggcgcagattatggtgtgtacaacctttctaattctggcgatgtggtcggccgc
gatgatcttgcccgcgcagtatttgagcactgtggggtatccggtgcggcggtcacatct
gttaccacagccgagtacgaggccctaacaggcccgttggccaagcgccccgcggagtcg
acgttcaacttgggcaagattgtggccacgggttttcaaccgcgcccatggcgggatgct
gtgcgggattacttgggcaccaagtag

DBGET integrated database retrieval system