KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_0360Help
Entry
CDCE8392_0360     CDS       T01700                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDCE8392_0360 (hemG)
Enzymes [BR:cdd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CDCE8392_0360 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
355470..356822
Genome map
AA seq 450 aa AA seqDB search
MRIAIIGAGLAGLTAAYRLRDHDVSVFEATDRIGGKLHTVAFQSGPTDMGAEAYLAFRED
TTAFFEELGLEVVSPSGLPSLLYVDGELHPMPMNTVMGIPGSSKGLEKLVSAETAARIDA
ESDSMDWPQEVTLGEVLRERFGDDLVDHVVSALQGGVYSSTSDDLSLRDTVPQLARALDR
LKEEGKPVTITAAVQSIMADREKRNKARGYKPSVFAAFPGGYAELYEALAEKSGAKIHID
AFITGIQWKDGFTLKGAEGTFDKVIVAVPAPTAAMLLKSVAPEASALLKNIKLASSAVVG
MKFDSAEGLPDNSGILVATDAEVTAKAFTFSSKKWPHLGQRGGALVRASFGRFGDDAIAR
ADEDLLVDTALDDLQTITGFDGRAAGLSEIYVQRWFGGLPVYGPGHSDLVAAIKDALPVG
IYATGAWADGVGVPAVIDSATKVAKLLEDH
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtattgcgatcattggtgcggggcttgcgggtttgactgcggcgtatcgtcttcgt
gaccatgatgtttcggttttcgaggcgactgaccgtattggtggcaagctgcatacggtt
gcgtttcagtctggccctacggatatgggtgcagaggcgtatttggcatttcgtgaggat
acgacggcctttttcgaggagttaggtcttgaggttgtgtcgccttcggggttgccgtcg
ttgttgtatgtcgatggcgagttgcatccgatgccgatgaatacggtgatggggattccg
ggctcatcgaagggtttggaaaagttggtgagtgcggagactgccgcgcgtatcgacgcc
gaatctgattccatggactggccccaggaggtgactctgggggaggttttgcgtgagcgt
tttggcgacgacctcgtggatcacgtggtgtcggcgttgcagggtggcgtgtattcctct
acttctgatgatctttcgttgcgggacacggttccgcagttggcgcgtgcgttggatcgt
ctgaaagaagaaggcaagccagtcacaattaccgctgcggtgcagtcgattatggctgat
cgtgagaagcgtaataaggcccgtggttataagccgagtgtgtttgcggctttccctggt
ggttatgcggagctgtatgaggcgctggcggagaagtcgggtgcgaagatccacattgat
gcctttattactggcattcagtggaaggatgggttcacactgaagggtgctgagggaacc
tttgacaaggtaattgtggcggttccagctccgacggcggcgatgttgttaaagtctgtg
gcaccggaggcgtcggcgttgctgaaaaacatcaagttggcgagctctgcggtggtgggc
atgaagttcgattccgcggaggggctgccggataattcgggcattttggttgctacggat
gctgaggttactgcgaaggcgttcacattttcttcgaagaagtggccacatttggggcag
cgcggtggcgcgttggtgcgtgcgtcgtttggccgttttggtgatgatgccattgcgcgt
gccgacgaagacttgctggtggataccgcccttgatgatcttcagactattacggggttt
gatggccgtgcggctgggctgtcggagatctatgtgcagcgctggttcggtggcttgccg
gtgtacggcccagggcatagcgatcttgtggctgcgattaaggacgcactgccagtaggt
atttatgccaccggcgcttgggctgatggcgtgggtgttcctgcggtgattgattctgca
actaaggtggcaaagctactggaagatcactga

DBGET integrated database retrieval system