KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_0465Help
Entry
CDCE8392_0465     CDS       T01700                                 

Definition
putative regulatory protein sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDCE8392_0465
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDCE8392_0465
   00052 Galactose metabolism
    CDCE8392_0465
   00500 Starch and sucrose metabolism
    CDCE8392_0465
   00520 Amino sugar and nucleotide sugar metabolism
    CDCE8392_0465
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDCE8392_0465
   00524 Butirosin and neomycin biosynthesis
    CDCE8392_0465
Enzymes [BR:cdd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDCE8392_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
462004..462888
Genome map
AA seq 294 aa AA seqDB search
MTHALGVDIGGTKIAVGIVDSTDPTTVISRHIVPTPDHDVIDRVRDAIAHIITPEVTSIG
IGAPGVIDETTGVVVSSGPTMQGWAGTRIADTIAAEFSLPVAVHNDVRVMGLGESIYGAG
RDYTNVLFVSLGTGVGGAIVRDGRLVASPHHTAGELRALIGRLPDGRADLLENFAAGPGL
AQRFGELYSEHAGRDLRFIMELYRAGDTHARDYITATLAAAGETIAGFASAIDVDAIIIG
GGVGNIGDAIIKPFAHGFAAHAIPPLGTIPIRQAQLGTDAPIVGAAHLGHSAIA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgcactcggtgtcgacatcggcggcactaaaatcgcagtcggaatcgtagac
agcacggaccccaccaccgtaatcagccgacacatcgtccccacacccgaccacgacgtg
attgaccgcgtacgcgacgcgatcgcccacatcatcaccccagaagtaactagcattggc
atcggcgcgccgggcgtaatcgacgaaaccacaggagtagttgtctcctccggtcccacc
atgcaaggctgggctggcacacgcatcgcggatactatcgccgcggaattttcgctaccc
gtcgccgtgcataacgacgtccgcgtcatggggctcggcgaatccatctacggcgccgga
cgcgactacaccaatgtgctctttgtcagccttgggacaggtgtcggcggcgccattgtt
cgtgacggacgcctcgtagcatccccgcaccacactgcaggcgaacttcgggcactcatc
ggcaggcttcccgacggccgcgcagacctcctagaaaacttcgccgcaggacccggcttg
gcacaaagattcggtgaactctactccgaacacgcaggtcgtgacctgcgattcatcatg
gagctctaccgcgcaggagacacccacgcccgcgactacatcacagcgacgcttgcagca
gcaggcgaaaccatcgcaggattcgccagcgccatcgacgtagacgccatcatcatcggc
ggcggagtaggcaacatcggcgacgccatcatcaaaccatttgcccacggattcgcagcc
cacgccattccaccgctaggaacgatccccatccggcaagcacaacttggcaccgacgca
cctatcgtcggcgcagcacaccttggccacagcgccatcgcataa

DBGET integrated database retrieval system