KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_0725Help
Entry
CDCE8392_0725     CDS       T01700                                 

Gene name
echA2
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CDCE8392_0725 (echA2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CDCE8392_0725 (echA2)
   00650 Butanoate metabolism
    CDCE8392_0725 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CDCE8392_0725 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDCE8392_0725 (echA2)
   00310 Lysine degradation
    CDCE8392_0725 (echA2)
   00360 Phenylalanine metabolism
    CDCE8392_0725 (echA2)
   00380 Tryptophan metabolism
    CDCE8392_0725 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDCE8392_0725 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CDCE8392_0725 (echA2)
   00281 Geraniol degradation
    CDCE8392_0725 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDCE8392_0725 (echA2)
   00627 Aminobenzoate degradation
    CDCE8392_0725 (echA2)
   00930 Caprolactam degradation
    CDCE8392_0725 (echA2)
Enzymes [BR:cdd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CDCE8392_0725 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
738279..739055
Genome map
AA seq 258 aa AA seqDB search
MAQVEVRIDGHLMCVTLNRHEARNALSAQMCDDITSALNNADEQARDTAAIRAVLIRSVG
TTFCAGADLGSTTQSDDAAEVTQSDFHDSLTRMLESVVSCGVPVIADIQGPAVGAGMQLA
LSCDLRLVHHAAWFKVPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVAT
GFALEIADSDSAIAYAHRIAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDA
REGQLARKQKRDPVFTGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaggtagaggtgcgtatcgacggccacctgatgtgtgtcaccttaaatagacac
gaggctcgcaacgcactttctgcacagatgtgcgatgatattacatctgctcttaataat
gcagatgagcaggcgcgtgacactgcagctattcgcgccgtgctcatccgctctgttggt
acgaccttttgtgccggagcagatttgggcagtaccacccaaagtgatgatgcggctgag
gtgacgcagtcggatttccatgactctcttacgcgcatgttggaatcggttgtttcctgt
ggagtcccagttattgctgatattcaaggaccagctgtcggcgctggcatgcagctggca
ttgagctgcgacctgcgtttggttcatcatgctgcatggtttaaggtcccggcggcgtct
cttgggttcgcgctggacggatggactattaatagggctcagtgtttgctgggcggtggt
tgggcgcgatcaattttcttgggcggcgcaacgctatcggcaccgcaggcggtggcaact
ggttttgcgctggagatcgctgattccgattctgcgattgcctatgctcatcgtattgct
ggaatggcacccttggcgctgcgacaacttaaatccgcgctcaacagtgctgattttgaa
tatgcgcttgttggggaatctcgtgatctttttgcccaatgttgggctagtacggatgct
cgcgaagggcagctggctcgaaaacaaaagcgagatccggtatttactggtcgctga

DBGET integrated database retrieval system