KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_0774Help
Entry
CDCE8392_0774     CDS       T01700                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CDCE8392_0774 (galU)
   00052 Galactose metabolism
    CDCE8392_0774 (galU)
   00500 Starch and sucrose metabolism
    CDCE8392_0774 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CDCE8392_0774 (galU)
Enzymes [BR:cdd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CDCE8392_0774 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
783637..784557
Genome map
AA seq 306 aa AA seqDB search
MTSPKSGNSCAVRTVIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAEEAAQLGATR
LAVITAPKKQEVLDHFNRFPELEATLESRGKKDQLAKVVRAAELIQPVSVVQETPLGLGH
AVGLAESVLDDDEDVVAVMLPDDLVLPMGVVEKMVEVRRQLGGSVLCAFDVPREDVYNYG
VFDIEECDYDGPYQVKSVKGMVEKPAVEDAPSTFVATGRYLLDRAIFDALRRITPGAGGE
LQLTDAIALLINEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLSDPTYGPHLKKVLRTI
LEEHGA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacccaagagtggtaattcgtgtgccgtcagaaccgtgatcgtcccagctgct
ggtttgggtacacggtttctccctgccacaaagaccgtccctaaggagctccttcctgtc
gtcgatacgccaggtatcgagctgattgctgaggaggccgcgcagttgggggcaacgcgt
ttggctgtgattacggcgccgaaaaagcaggaagtgttggatcacttcaacaggttccca
gagctggaagcaacgttggaaagtcgtggcaagaaggatcagctggcaaaggttgtgcgt
gctgctgaactgattcagccggtttctgtggttcaagagactccgcttggtctggggcat
gcagtggggttggcggaaagcgtgttggatgacgatgaagacgtcgtagctgtcatgctt
ccggatgacttggtgctgcccatgggcgttgtggaaaagatggtggaggtgcgtcgccag
ctgggaggctctgtgctgtgcgctttcgatgttcctcgtgaagatgtgtataactacggc
gtctttgatattgaggagtgcgattacgacggcccttaccaagtcaagagtgtgaaaggc
atggtggaaaagccagccgtagaagacgcaccttcgacgtttgttgcaacaggtcgttat
cttttggatcgtgcgatttttgatgcgcttcgccgtatcacccctggtgcgggcggtgag
ctgcagcttactgatgctattgcgttgcttattaatgaggggcatccagtccacatcttg
gttcacgatggaaagcgccatgatttgggaaatcctggtggttatatcccagcggtggtg
gattttggtttgtcggatccgacgtatggcccacatttgaagaaggtcctgcgtaccatt
ttggaagagcacggcgcttaa

DBGET integrated database retrieval system