KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_0788Help
Entry
CDCE8392_0788     CDS       T01700                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
cdd00900  Terpenoid backbone biosynthesis
cdd01100  Metabolic pathways
cdd01110  Biosynthesis of secondary metabolites
cdd01130  Biosynthesis of antibiotics
Module
cdd_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDCE8392_0788 (ispE)
Enzymes [BR:cdd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CDCE8392_0788 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEX71783
Position
800480..801415
Genome map
AA seq 311 aa AA seqDB search
MTSYAITAVASSKVNLHLGVGNARDDGYHELVTVFQSLSLHDTITVTPAADDMHDAEDQG
IVATLSVSGDSAQAVPTDATNLAWQAAEKMYKAHRRNGGAPAKRVHIAIDKGIPVAGGMA
GGSADAAATLAAMAQYLGNTVTEQEILSIAAELGSDVPFTYLGDTRLGTGRGEQLVPVLS
RGTYHWALAFSAQGLSTPEVFRKIDQMDRQPHLDVTALNAALITGDPHKVAAHLHNDLQA
AALSLRPELRTTLEQGRTAGALAGIVSGSGPTCAFLCEDAETAQAVAAELSVHYRTAVAT
GPVRGAHVKGH
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacaagttacgccatcacagcggtcgcctcgtcaaaagtcaaccttcatcttggagtc
ggcaacgcgcgtgacgacggctaccatgagctcgtcaccgtatttcaatcactgagcctg
cacgacaccatcacggtgacaccagccgcagatgatatgcacgatgccgaggaccaagga
atcgtcgcaacgctgagcgtgagcggcgacagtgcccaagccgtgcctaccgacgccacc
aacctcgcatggcaggcagccgagaaaatgtacaaggcacatcgtcgcaatggtggagcc
cccgccaagcgcgtgcacatcgccatcgacaaagggattccggtcgcaggcggaatggcc
ggtggatcggccgatgccgctgccacgttagcagccatggcacagtacttgggcaacacc
gtcaccgagcaagaaatcttgagcattgcagctgagctgggctccgacgtgccctttacc
tacctcggtgatactcggctaggaacaggccgcggtgaacaactcgtcccagtcttgtcg
cggggaacctatcattgggcactggcgttttctgcgcaaggcctatctacacccgaggta
ttccgcaaaatcgatcagatggaccgccaaccgcatctcgatgtcaccgcgctgaacgca
gcgctgattacgggagatccccataaagtagcagcgcatttgcacaatgatctccaagca
gcagcgctttcactacgccccgaattacgcaccaccctagaacaaggtcgtaccgctgga
gcactggccggaatcgtatcgggatccggacccacctgcgccttcctttgcgaagatgcc
gaaactgcccaagcagtagccgcggaactaagcgtgcactaccgaaccgctgtcgctacc
ggacctgtccgcggcgcccatgtgaaaggacactag

DBGET integrated database retrieval system