KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_0887Help
Entry
CDCE8392_0887     CDS       T01700                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdd01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cdd00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
903738..904835
Genome map
AA seq 365 aa AA seqDB search
MLDLTTNPIDLTRALVDIESPSHYEKNIADAIEQALHAIDNVEVLRHGNTLVARTHRGLG
ERVILAGHIDTVPIADNVPSHMEGDVMFGCGTVDMKSGMAVYLHAFATLANHPALAKDLT
VVCYEGEEVASEYNGLGHVQAAHPDWLSGDLALLGEPSGAVIEAGCQGTIRLRVTAHGVR
AHSARSWLGDNAMHKLAPVITNIAQYHAQEMLVDGCLYHEGLNIVHCESGVATNTIPDEA
WMFVNFRFAPNRSVDEALAHMLEVLDLPEGVTYDIDDAVPGARPGLDRPAAAALLEATGG
KFRAKYGWTDVSRFSEIGVPAVNFGPGDPAYCHKKDEQCPVSMITEVSRTLVHYLTSTNS
QTTGA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatttgactacgaatcccattgacctcacccgcgcacttgttgatatagaaagc
ccctcccattacgaaaagaacatagccgacgccatcgagcaagctcttcatgccatcgac
aatgttgaagtgctacgccacggcaatactcttgttgctcgtacccatcgaggactagga
gaaagagtaatcctcgccggccacatcgacaccgtcccaatagccgacaacgttcctagc
cacatggaaggcgacgtaatgttcggctgcggcaccgtcgatatgaaatcgggcatggct
gtctatcttcatgcctttgccaccttggctaaccacccggcgctggcgaaggacttgacc
gtcgtctgttatgagggcgaggaagtcgctagtgaatacaacgggctggggcatgtgcag
gcagctcaccccgactggttaagtggcgatctcgccctcctaggcgagccttccggcgct
gtgatcgaagctggatgccaaggaacgattcgtttgcgcgtcaccgcccatggtgtgcgc
gcacactcggcacggtcgtggctaggagacaacgccatgcacaaattagcgccagttatt
acgaatatcgcacagtaccacgcccaagaaatgcttgtcgacggctgcctctaccacgag
ggcctcaacatcgtgcattgcgaatctggggttgccacgaacactatccccgatgaggcc
tggatgtttgttaacttccgtttcgcacctaataggagtgttgacgaagccctagcccac
atgctggaggtgttggatctacccgagggggtgacctatgacatcgacgatgctgttcca
ggggcacgtccgggtttggatcgtccggcagctgccgccctcctagaggcgacaggcgga
aaattccgcgcaaagtacggttggacggatgtgtcgaggttttctgagattggtgttcca
gcggtgaactttggtcctggggatccggcatattgccataaaaaagacgaacaatgccca
gtcagcatgattaccgaagtctctcgcacgctggtgcactatctcacgagtacgaattcc
cagacgacaggagcctga

DBGET integrated database retrieval system