KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_0994Help
Entry
CDCE8392_0994     CDS       T01700                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
cdd00010  Glycolysis / Gluconeogenesis
cdd00030  Pentose phosphate pathway
cdd00051  Fructose and mannose metabolism
cdd00052  Galactose metabolism
cdd00680  Methane metabolism
cdd01100  Metabolic pathways
cdd01110  Biosynthesis of secondary metabolites
cdd01120  Microbial metabolism in diverse environments
cdd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDCE8392_0994 (pfkA)
   00030 Pentose phosphate pathway
    CDCE8392_0994 (pfkA)
   00051 Fructose and mannose metabolism
    CDCE8392_0994 (pfkA)
   00052 Galactose metabolism
    CDCE8392_0994 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CDCE8392_0994 (pfkA)
Enzymes [BR:cdd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CDCE8392_0994 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CDCE8392_0994 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEX71987
Position
1020332..1021360
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYQDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKSGLDQIKANLEDAGIDALIPIGGEGTLKGAKWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEQPFDIAEICKAMERRFQMGEKYGIIVVAEGALPKEGTMDFVEGGVDQ
FGHQTFNGIGQVIGEEIKKRLGHDVRTTVLGHIQRGGTPTSYDRVLATRYGVHAARACHN
GDYGKMVALHGEHIDLIPLEDAVDTLKTVPEGRYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactcttacatccggcggcgattgccccggcctcaacgctgtgatccgc
ggcattgtccgcacatgttctgagtacggctcgaccgtcgttggataccaagacggctgg
gtggggctcatggaagacaagcgcattcaactatatgacgatgaaaacatcgatcgtatc
ctgttgcgcggcggaaccattttgggtaccggccgccttcaccctgacaagtttaagtct
ggtcttgaccagattaaggcaaaccttgaggatgcaggtattgatgcactgattcctatc
ggtggcgaaggtacactcaagggtgccaaatggctatctgataatggtattcctgtagtt
ggcgtgcctaagacgatcgacaacgacgttaacggtacggactacacttttggctttgat
accgcagtctctgttgctacggatgctatcgaccgactgcacaccacagctgagtctcac
aaccgtgtgatgatcgttgaggttatgggtcgtcacgttggctggattgcgctgcacgcc
ggcatggcaggcggtgcgcattacacagtcattcctgagcagccatttgatattgcagag
atctgcaaggcaatggaacgccgcttccagatgggtgaaaagtacggcattatcgtcgtg
gcggaaggtgcattgcctaaggaaggcacgatggactttgtcgagggcggcgtcgaccaa
tttggccaccaaacgtttaatggcattggtcaagtaattggtgaggaaatcaagaagcgc
ctcggccatgacgttcgtaccacggttttgggtcatatccagcgtggtggcacacctact
tcttatgaccgcgttttggctacccgttacggtgttcatgccgcacgtgcgtgccacaac
ggcgattacggcaagatggttgcgttgcacggtgaacatatcgatctgattccgctcgag
gacgcggtagatacgctaaagactgtccctgaaggacgctaccgcacagcacgcgccctg
tttggctaa

DBGET integrated database retrieval system