KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_1211Help
Entry
CDCE8392_1211     CDS       T01700                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
cdd00010  Glycolysis / Gluconeogenesis
cdd00051  Fructose and mannose metabolism
cdd00562  Inositol phosphate metabolism
cdd01100  Metabolic pathways
cdd01110  Biosynthesis of secondary metabolites
cdd01120  Microbial metabolism in diverse environments
cdd01130  Biosynthesis of antibiotics
cdd01200  Carbon metabolism
cdd01230  Biosynthesis of amino acids
Module
cdd_M00002  Glycolysis, core module involving three-carbon compounds
cdd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDCE8392_1211 (tpi)
   00051 Fructose and mannose metabolism
    CDCE8392_1211 (tpi)
   00562 Inositol phosphate metabolism
    CDCE8392_1211 (tpi)
Enzymes [BR:cdd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CDCE8392_1211 (tpi)
Exosome [BR:cdd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CDCE8392_1211 (tpi)
  Exosomal proteins of bladder cancer cells
   CDCE8392_1211 (tpi)
  Exosomal proteins of melanoma cells
   CDCE8392_1211 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM BCSC_C
Motif
Other DBs
NCBI-ProteinID: AEX72204
Position
complement(1274145..1274927)
Genome map
AA seq 260 aa AA seqDB search
MARTPLIAGNWKMNLDHLQAVATVQKLAFALPKEYYEKVDVAVTVPFTDLRSVQTLIEGD
KLAITYGAQDVSQHEAGAYTGEISAQMLAKLGCTWVVVGHSERREYHGESSELVAVKAKA
ALNQGISPIVCVGEPLEIREAGTHVEYVVEQTRASLAGLTADDLAKTVIAYEPVWAIGTG
KVASAADAQEVCAAIRNLIIELAGKEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATVVD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtactccacttatcgcaggaaactggaagatgaatcttgatcatcttcaagct
gttgcaactgtgcaaaaacttgcttttgcacttccaaaggaatactacgaaaaagtcgac
gtagctgtcaccgtaccttttactgatcttcgctctgttcaaacacttatcgaaggcgat
aagctcgctataacttatggtgctcaagatgtttcgcagcacgaggctggtgcctacact
ggtgaaatctctgcccagatgcttgccaaactcggatgtacttgggttgttgttgggcac
tcagagcgtcgtgagtaccatggcgaatcttcggagcttgttgcagtcaaagctaaagct
gcgttgaaccaaggaattagccccatcgtttgtgttggagagccccttgaaattcgtgaa
gctggaacacacgtagaatatgtcgtcgaacagactcgcgcatcgttggcgggtcttact
gcagatgatttggcaaagactgttatcgcctacgaacccgtatgggctattggtacgggt
aaagtagcatccgccgccgatgcacaggaagtctgcgcagcaattcgtaacctcatcatt
gagcttgctggtaaagaagtagctgaagggcttcgcattctttatggcggatcagttaaa
gcagaaacagtagccgagatcgtaggtcaaccggatgttgatggcggcttagtgggtggc
gcttctcttgacggtgaagcattcgccaaactagcagctaatgcagcaactgttgtcgac
tag

DBGET integrated database retrieval system