KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_1474Help
Entry
CDCE8392_1474     CDS       T01700                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDCE8392_1474 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    CDCE8392_1474 (hisD)
Enzymes [BR:cdd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CDCE8392_1474 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1550792..1552123)
Genome map
AA seq 443 aa AA seqDB search
MLNVIDLRGHVPTTSELRRTLPRGGTDINSVLPIVEPVVTDVKNRGAAAALDYGEKFDHV
RPPSIRVPQDVIDQALDSLDPNVIEALKESIARVRAVHSEQLPAQHTTSFGEGATITEKF
IPVSRVGLYVPGGNAVYPSSVIMNVVPAQEAGVESLVVASPPQKDHGGWPHPTILAAAKL
LGVTEVWATGGAQAVALLAYGDDTQQNSAEVLEPVDMITGPGNIFVTAAKRLVRGVVGID
SEAGPTEIAIVADAQANPVWIAYDLISQAEHDVLAASVLITDSEELAQRVNEEVAARYSV
TRNADRVSEALKGQQSGIVLVDDLPTAVIVADAYAAEHLEIHTAESHKVAEQIRNAGAIF
VGGYSPVPLGDYSAGSNHVLPTSGSARYSSGLSTHTFLKPVNVIYYDEVALKEISDTVIT
LADAEDLPAHGEAIRTRFENLGN
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatgtgattgatcttcgcggacacgttcccaccacaagtgagctgcgtagaaca
ttgccacgaggcggaacggatattaattcggtattaccgatcgtcgagccagtggttacc
gacgttaagaatagaggtgctgctgccgcacttgattatggagaaaaattcgatcacgtt
cgcccaccatcaattcgcgtgccgcaagatgtcatcgatcaggcactggacagcttggac
cccaatgtcattgaggcactgaaagaatcgatcgcccgagtgcgtgcagttcactctgag
cagcttccagcccaacacaccacttcctttggtgaaggcgcaacaattacagagaagttc
ataccagtatctcgcgttggcctctacgttcctggtggaaatgctgtgtatccctccagc
gttattatgaacgttgtccccgctcaagaagcgggagtggaatcattagttgtggcttct
cctccacaaaaagatcacggtggatggcctcaccccactattttggccgcagctaagctt
ttgggagtaactgaggtttgggctacgggcggtgctcaagcagtggcattgttggcttat
ggcgatgatacccagcaaaatagtgctgaagtcttagaaccggtcgatatgataactggt
cctggcaatatctttgtcaccgctgccaagcgtttggtgcgcggggtagtgggcatcgac
tctgaggctggtccaacagaaatcgctatcgttgccgacgcgcaggcgaacccagtctgg
atcgcctatgatctcatcagccaagctgaacatgatgttcttgctgcttcggtacttatc
acggactccgaagagttggcacagcgcgttaatgaggaagtcgctgcccgctacagtgtc
actcgcaacgcagatcgcgtatctgaggctctcaaaggccagcagtcaggcatcgtgctt
gtcgacgatctcccgaccgccgttatagtggcagacgcatacgctgcggaacacttggaa
attcacacagcagagtcccacaaggtggcagaacaaattcgaaacgctggtgcaatattt
gttggcggatattctccggtaccgctaggagattactcagcgggttcgaaccacgtactg
ccaacctctggaagcgctcgttatagctccggactttctacgcataccttcctcaagcca
gtcaacgttatttactacgatgaggtggcacttaaagaaatttccgacaccgtgatcacc
ttggctgatgccgaggaccttcctgcacacggcgaagcaattcgtacgcgctttgaaaat
cttggcaactag

DBGET integrated database retrieval system