KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_1519Help
Entry
CDCE8392_1519     CDS       T01700                                 

Gene name
crtE
Definition
putative polyprenyl synthase (EC:2.5.1.30)
Orthology
K13787  
geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDCE8392_1519 (crtE)
Enzymes [BR:cdd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     CDCE8392_1519 (crtE)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     CDCE8392_1519 (crtE)
    2.5.1.29  geranylgeranyl diphosphate synthase
     CDCE8392_1519 (crtE)
Prenyltransferases [BR:cdd01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CDCE8392_1519 (crtE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1601764..1602939
Genome map
AA seq 391 aa AA seqDB search
MGLKPAPNLQFLRNVNQLSTHPAGISACHHSLPSFSEVPAAVEEVLAEFFEGRKRKVAKI
GVPVSNAVELLVEYVLGGGKRIRPTYAWAGFVASGGLTNKTEDPGAVLTAIGSLELIQAC
ALIHDDIIDASDTRRGNPTVHRVAERTHAESHRLGDSARFGESIAILVGDLAMVWADDMF
HNSGLSDAAIRRASNAWRGMRTEVIGGQLLDIYIESTGSESIELAETVNRFKTAAYTIER
PLHIGAALAGADDQTVHCLRNYGRDIGLAFQLRDDLLGVFGDPSVTGKPAGDDLREGKRT
VLVAKALEILESAGSIHEAEMIRRDLGAVSGAEDIAQLASIIRSSGAADAVEERIATLRT
SGLAHISNDVIDAEAQDFLKHLAIKATSRSF
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggtttaaagcctgcaccgaatttacagtttttaaggaatgtgaaccagttgtctacg
caccccgccggtatctctgcatgccatcactcactgccttcgttttcggaggtcccagca
gcagtagaagaagtactcgcggagtttttcgaaggccgtaaacgcaaggtagccaagatt
ggtgttccagtgagcaatgcggttgagctgctggtcgaatatgtccttggcggtggaaaa
cggattcgtcctacgtatgcgtgggcgggttttgttgctagtggcggattaactaataag
acggaagatcccggcgcggtactcacagcaattggctctctggaactgatccaagcgtgt
gcgcttatccacgacgacattatcgacgcttccgatacgaggcgtggtaatccgactgtg
caccgtgttgcagaacgcacccatgcagaatcccatcgcttgggcgattccgcacgtttt
ggcgagtcgatcgcaattttggttggcgatcttgcgatggtgtgggcagatgatatgttc
cataactctgggcttagtgatgctgcaattcgtcgtgcttcgaatgcgtggcgtggcatg
cgcactgaagttattggcggacaacttcttgatatttacattgaatccactggtagcgag
agcatcgaactagcggaaaccgtcaatcgttttaaaactgccgcctatacgattgagcgc
cctcttcacattggtgcggcgttggcgggcgctgatgaccagacagttcactgtctacga
aattatggccgtgatatcggcttggcgttccagcttcgcgacgatcttttaggtgtattt
ggtgacccaagtgttacgggtaagccagctggcgatgacttgcgtgaaggaaagcgcacg
gtattggtggccaaagcattagaaatcttggagtctgcgggctcgatccacgaggcggaa
atgattcgtcgtgacttaggtgcagtgtcgggggccgaagatattgcacaattggcttcg
attattcgctcctctggtgccgccgatgcggtggaagagcgcatcgcaaccttgcgaact
tctggccttgcgcacattagcaatgatgttattgatgcagaggcccaagattttctaaaa
cacctagctatcaaggctacgtcgagaagcttctaa

DBGET integrated database retrieval system