KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_1519Help
Entry
CDCE8392_1519     CDS       T01700                                 

Gene name
crtE
Definition
putative polyprenyl synthase (EC:2.5.1.30)
Orthology
K13787  
geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C10-C20 isoprenoid biosynthesis, bacteria
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cdd00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1601764..1602939
Genome map
AA seq 391 aa AA seqDB search
MGLKPAPNLQFLRNVNQLSTHPAGISACHHSLPSFSEVPAAVEEVLAEFFEGRKRKVAKI
GVPVSNAVELLVEYVLGGGKRIRPTYAWAGFVASGGLTNKTEDPGAVLTAIGSLELIQAC
ALIHDDIIDASDTRRGNPTVHRVAERTHAESHRLGDSARFGESIAILVGDLAMVWADDMF
HNSGLSDAAIRRASNAWRGMRTEVIGGQLLDIYIESTGSESIELAETVNRFKTAAYTIER
PLHIGAALAGADDQTVHCLRNYGRDIGLAFQLRDDLLGVFGDPSVTGKPAGDDLREGKRT
VLVAKALEILESAGSIHEAEMIRRDLGAVSGAEDIAQLASIIRSSGAADAVEERIATLRT
SGLAHISNDVIDAEAQDFLKHLAIKATSRSF
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggtttaaagcctgcaccgaatttacagtttttaaggaatgtgaaccagttgtctacg
caccccgccggtatctctgcatgccatcactcactgccttcgttttcggaggtcccagca
gcagtagaagaagtactcgcggagtttttcgaaggccgtaaacgcaaggtagccaagatt
ggtgttccagtgagcaatgcggttgagctgctggtcgaatatgtccttggcggtggaaaa
cggattcgtcctacgtatgcgtgggcgggttttgttgctagtggcggattaactaataag
acggaagatcccggcgcggtactcacagcaattggctctctggaactgatccaagcgtgt
gcgcttatccacgacgacattatcgacgcttccgatacgaggcgtggtaatccgactgtg
caccgtgttgcagaacgcacccatgcagaatcccatcgcttgggcgattccgcacgtttt
ggcgagtcgatcgcaattttggttggcgatcttgcgatggtgtgggcagatgatatgttc
cataactctgggcttagtgatgctgcaattcgtcgtgcttcgaatgcgtggcgtggcatg
cgcactgaagttattggcggacaacttcttgatatttacattgaatccactggtagcgag
agcatcgaactagcggaaaccgtcaatcgttttaaaactgccgcctatacgattgagcgc
cctcttcacattggtgcggcgttggcgggcgctgatgaccagacagttcactgtctacga
aattatggccgtgatatcggcttggcgttccagcttcgcgacgatcttttaggtgtattt
ggtgacccaagtgttacgggtaagccagctggcgatgacttgcgtgaaggaaagcgcacg
gtattggtggccaaagcattagaaatcttggagtctgcgggctcgatccacgaggcggaa
atgattcgtcgtgacttaggtgcagtgtcgggggccgaagatattgcacaattggcttcg
attattcgctcctctggtgccgccgatgcggtggaagagcgcatcgcaaccttgcgaact
tctggccttgcgcacattagcaatgatgttattgatgcagaggcccaagattttctaaaa
cacctagctatcaaggctacgtcgagaagcttctaa

DBGET integrated database retrieval system