KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_1526Help
Entry
CDCE8392_1526     CDS       T01700                                 

Gene name
glk
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
cdd00010  Glycolysis / Gluconeogenesis
cdd00052  Galactose metabolism
cdd00500  Starch and sucrose metabolism
cdd00520  Amino sugar and nucleotide sugar metabolism
cdd00521  Streptomycin biosynthesis
cdd01100  Metabolic pathways
cdd01110  Biosynthesis of secondary metabolites
cdd01120  Microbial metabolism in diverse environments
cdd01130  Biosynthesis of antibiotics
cdd01200  Carbon metabolism
Module
cdd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDCE8392_1526 (glk)
   00052 Galactose metabolism
    CDCE8392_1526 (glk)
   00500 Starch and sucrose metabolism
    CDCE8392_1526 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CDCE8392_1526 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDCE8392_1526 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CDCE8392_1526 (glk)
Enzymes [BR:cdd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDCE8392_1526 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase TCR Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AEX72514
Position
complement(1610035..1610988)
Genome map
AA seq 317 aa AA seqDB search
MTNMSESVTVGFDIGGTNMRAAAVTDSGLIIDSVSVPTPKSSEALEKGIISLVAQLREKH
EVSAVGLAVAGFLDPDCEIVRFAPHLPWRDRPVRAELEDALGLPVRLEHDANSAAWGEYR
FGAARGSQNWVLFAVGTGIGATLMHEGEIYRGAFGTAPEFGHLTVVPQGRQCSCGKSGCL
ERYCSGTAIEATARELLDADRGRDSMVAAAYHSGTLSGKTVTEAARQGDVFAIEVFDDFA
EWMGRALSIVCDVLDPGQIVIGGGLSTSSDLFLEKATQHMAQQIVGAGYRPLPTVVCAEL
GGDAGMIGVSDLARRRV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatatgtcagaatctgtcactgtcggattcgacatcggtggaaccaatatgcgg
gcagcggcggtgacggattccggtttgatcatcgactccgtttcggttcctacccctaaa
tcttctgaggctctggaaaaaggcattatttctctggtagctcaattgcgggaaaagcat
gaggtttcggctgtaggtcttgccgttgcaggttttttggatcctgattgcgaaatcgtt
cgctttgctcctcatctgccgtggcgtgatcgcccagtgcgtgcggaattagaggacgcg
ttgggacttcctgttcgtcttgaacatgatgcgaattctgcagcgtggggagaataccgc
ttcggagcggcacgtggttcgcaaaactgggtcttatttgcggttggcactggtatcggt
gccacactgatgcatgagggtgagatctaccgtggtgcttttggtacagctcctgagttc
ggccaccttaccgttgtccctcaaggtcggcagtgttcttgtggcaagagtggctgtttg
gaacgttattgttccggcactgctattgaagcgacagcgcgtgagcttctcgacgccgat
cgtggccgcgactcgatggttgctgctgcttatcattcgggcacattgagtgggaaaact
gtgaccgaagcggcccgccagggtgatgtttttgccatcgaggtctttgatgattttgct
gaatggatgggtcgcgccttgtctatcgtgtgtgatgttttagatccgggacagatcgtg
attggtggcgggttgtccacgtcaagcgatttgttcttggaaaaggctactcagcacatg
gcacagcagattgtcggggctgggtatcgcccccttccgacggtggtgtgtgccgaattg
ggtggcgatgccggtatgatcggggtatctgatctggctcggcgtcgcgtctag

DBGET integrated database retrieval system