KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_1545Help
Entry
CDCE8392_1545     CDS       T01700                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide acetyltransferase (EC:2.3.1.12)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDCE8392_1545 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDCE8392_1545 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CDCE8392_1545 (sucB)
Enzymes [BR:cdd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CDCE8392_1545 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1630919..1632532
Genome map
AA seq 537 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDTVTADEPLLEVSTDKVDTEVPSPVSGVLLEIK
FEEDDTVDVGDVIAIIGEEGDAPAAKEEPAEEPKAEAPKAEAADSTDVVMPELGESVTEG
TITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTVDVGDVIVRVG
TPGSAPAAKEEPAEEPQQEAPKEEPKAEAPKAEAKKEAPAKNINNENVPYVTPLVRKLAD
KHGVDLTTVEGTGIGGRIRKQDVLAAAGVGAAPAAQAAPAQPVSAASTKSVDPEKQKLIG
TTQKVNRIREITARKTVEALQISAQLTQLHEVDMTKVAELRKANKPAFQEKHGVNLTYLP
FFAKAIVEALVAHPNVNASYNAETKEMTYHADVNLSIAVDTPAGLLTPVIHKAQELSLPE
LAKAIVDLADRARNNKLKPNDLSGGTFTITNIGSEGALSDTPILVPPQAGILGTGAIVKR
PVVITEDGIDSIAIRQMVYLPLTYDHQIVDGADAGRFLTTIKDRLETANFEGDLELS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgtaatgcctgaactgggcgaatccgtcaccgaaggtaccatcacc
cagtggctgaagtccgttggtgacacggtcactgccgacgagccgttgctcgaggtatct
actgacaaggtcgacactgaagttccttcgcctgtctccggtgtcttgcttgagatcaag
tttgaggaagatgacaccgtagacgtcggagacgttattgcgattattggcgaagaaggc
gacgctccagcagccaaggaagagccagccgaggagccaaaagccgaggcaccaaaggct
gaagcagctgactccaccgacgtagtcatgccagaactcggcgaatccgtcaccgaaggc
accatcacccagtggctgaagtccgttggcgacaccgtcgacgttgacgaaccactcctc
gaagtctccactgacaaggtagacaccgaagtcccatccccagtcgctggcaccatcctc
gaaattctcttcaacgaagacgacaccgtcgacgtcggagacgtaatcgttcgcgttggc
accccaggatctgctccagctgccaaggaagagccagccgaggagccacagcaagaagca
ccaaaggaagagccaaaagctgaggcaccaaaggctgaagcaaagaaggaagctcctgcc
aagaacatcaacaacgagaacgtcccttacgtcactccactggtccgcaagctggctgac
aagcacggcgttgatctgaccactgtggaaggcactggtatcggtggacgcatccgcaag
caggatgttttggctgccgctggtgttggcgcagctcctgcagcacaggctgctcctgcc
cagccagtttctgcagcatccaccaagtccgtggatccagagaagcagaagctgatcggt
acaactcagaaggtcaaccgtatccgagagatcaccgcgcgcaagactgtggaagctttg
cagatttctgctcagctcacccagctgcatgaggtcgatatgactaaggttgcggaactg
cgtaaggccaacaagccagccttccaagaaaagcacggtgtgaacctcacctacttgcca
ttctttgcaaaggcaattgttgaggctttggttgctcacccgaacgtcaatgcgtcctac
aacgctgagacaaaggagatgacctaccacgctgatgtcaacctctccatcgccgttgat
accccagctggtctgcttacccctgttatccacaaggctcaagagttgtccttgcctgag
ctcgctaaggcaattgtcgatttggctgaccgcgctcgtaacaacaagctcaagccgaat
gatctttccggtggcaccttcaccattaccaacattggttctgagggcgctctcagcgat
accccaatcttggttccaccacaggcaggtatcttgggcaccggcgctattgttaagcgg
ccagtagtcatcacggaagacggcatcgattcgattgctattcgccagatggtctacttg
ccacttacctacgatcaccagatcgtcgatggtgccgatgcaggtcgtttcttgaccacc
atcaaggatcgccttgagactgcaaacttcgaaggcgacctcgaactgtcctag

DBGET integrated database retrieval system