KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_1712Help
Entry
CDCE8392_1712     CDS       T01700                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cdd00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1806526..1806975
Genome map
AA seq 149 aa AA seqDB search
MNALLIIDIHANSPAPEATEITHAIALHLGQHRGDYSHVIAALQGTIADELAGTTFGNQF
IKDPATQALSAFERTDATGTKLGDWLRANNIDRLDVVGLDTELGIRSSVLDALAQGFDVH
VHKKLCAAVSHDNARAAYNEMDMCGALFE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgcttcttattatcgatatccacgccaactcccctgcccccgaggccaccgag
atcacccacgccatcgccctacatctcggccagcaccgcggcgactactcccacgtcatc
gcagctctccaaggcactatcgccgatgagctagccggtactacctttggtaatcaattc
attaaagaccccgccacccaggccttatccgcttttgagcgcacagatgccaccggcacc
aaactcggcgactggctccgtgccaacaacatagatcgcctcgacgttgtaggccttgac
accgaactcggcattcgctccagcgtgttagacgcactcgcccaaggatttgatgtgcac
gtgcacaaaaaactctgcgctgccgtatcacacgacaacgcccgcgctgcctataacgaa
atggacatgtgcggggcgttattcgaataa

DBGET integrated database retrieval system