KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_1856Help
Entry
CDCE8392_1856     CDS       T01700                                 

Gene name
deoA
Definition
Thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cdd00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1956084..1957367)
Genome map
AA seq 427 aa AA seqDB search
MAEQFDAVDIIRIKRDGGELTTEQINWVIDAYTRGAIGDEQMAALNMAIFIRDMNRREIV
DWTKAMINSGETMDFSALGKKTTDKHSTGGVGDKLSLPLGPLVASYGLAVPMLSGRGLGH
TGGTLDKLEAIPGFEVDIDNDRMMNILKDAGVVIASAGSGLAPADKKIYALRDITSTVDC
VPLIASSIMSKKIAAGADSLILDVKVGSGAFMKDLDHARELARTMVDLGNDAGVHTRALL
TDMSTPLGKKIGNSLEIEETVEVLAGGGPEDVVKLTCELARNMLEMAGIHDADVEERLKD
GRAMDVWKRMVRAQGGDPEAPMARAEHTHEVVADRDGYLMELDALALGVGSWRLGAGRAR
KEDPVQLTAGIEIHADLGQKVVKGQKLLTLHTETPDKFDRALESIIPGIAIGDEQPAERQ
IILDRIV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacaattcgacgccgtggacatcattcggatcaagcgcgatggcggcgaactg
accaccgaacaaatcaactgggtgatcgacgcctacacccgcggagccatcggcgacgag
caaatggcagcactcaacatggccatcttcatccgcgacatgaaccgccgcgagattgtc
gactggaccaaagccatgatcaactccggtgaaaccatggacttcagcgcccttggcaaa
aagaccaccgacaaacactccaccggtggcgtgggcgacaaactctccctgccactcggc
ccactcgtggcaagctacgggctcgcagtgcctatgctctccggccgcggactcggccac
accggcggcaccctagacaagctcgaagcaatcccaggcttcgaggtagacatcgacaac
gaccgcatgatgaacatcctcaaagatgccggcgttgttatcgcctccgcaggatccgga
cttgcacccgcagataagaagatctacgcgctgcgcgacatcacctccaccgtcgactgc
gtcccactgatcgcaagctccatcatgagcaagaagatcgccgccggtgccgactccctc
atcttggacgtcaaggtcggaagcggtgcctttatgaaagacctcgaccacgcccgcgaa
ctcgcccgcaccatggtcgacctaggtaacgacgcaggcgttcacacccgtgcgctgctc
accgacatgtccacaccactgggcaagaagatcggtaactccctcgaaatcgaggaaacc
gtcgaggttctcgccggcggcggcccagaagacgtggtcaagctcacctgcgaacttgcc
cgcaacatgctcgaaatggccggaatccacgacgcagacgttgaagaacgcctcaaagac
ggacgcgccatggacgtgtggaagcgcatggtccgcgcacaaggcggcgacccagaagcc
ccaatggcacgcgcagagcacacccatgaagttgtcgccgaccgcgacggctacctcatg
gaactcgacgccctcgcgctcggtgttggcagctggcgcctcggtgccggacgcgcacgc
aaagaagacccggtgcagctcaccgccggtatcgaaatccacgccgatctgggccaaaaa
gttgtcaagggacaaaaactgctcaccctgcacactgaaaccccagacaagttcgaccgt
gccctcgaatccatcattcctggcatcgcgatcggtgacgaacaaccagctgaacgtcag
atcatcctcgaccgaatcgtctaa

DBGET integrated database retrieval system