KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_1880Help
Entry
CDCE8392_1880     CDS       T01700                                 

Gene name
folK
Definition
putative 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CDCE8392_1880 (folK)
Enzymes [BR:cdd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CDCE8392_1880 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1981587..1982066)
Genome map
AA seq 159 aa AA seqDB search
MRAVLSIGSNMDDRYALLRTVVEEFAGQIVAASSIYSTPPWGVEDQDEFLNAVVIVDVDS
SPLELLRRGQRLEEAACRRRLRHWGPRTLDVDVVTIYNDDGTQMRSTDPELTLPHPYAHE
RAFVLVPWAEADPEAELLGQKVAQRAAALGETFPVVGSL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagtgctttctataggttcgaatatggatgaccgctatgccttgctgcgaacg
gtcgtcgaagaattcgcagggcagatcgtggcagcatcctcgatctactccacgcccccg
tggggagtagaggaccaagacgagttcctcaacgcggtagtcattgtggacgtcgatagt
tcaccccttgagctgctaagacgtggccagcgcctagaagaagccgcgtgtcgacgtcgc
ctgcggcactggggtccgcgcaccctcgacgtcgatgtcgtaaccatctacaacgacgac
ggcacgcagatgcgatccaccgaccccgagctgaccctgccgcacccctacgcccacgag
cgagcctttgtgcttgtgccttgggcagaagcagaccccgaagctgaattgctaggccag
aaagtagcgcagcgcgccgcagcactgggcgaaacatttccggtggtgggaagcctatga

DBGET integrated database retrieval system