KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_1882Help
Entry
CDCE8392_1882     CDS       T01700                                 

Definition
putative dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CDCE8392_1882
Enzymes [BR:cdd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CDCE8392_1882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1982447..1983283)
Genome map
AA seq 278 aa AA seqDB search
MSAKNLIIPERTAVMGIVNVTEDSFSDGGRWLDIDAAIDHARDLVAAGADIIDVGGESTR
PGATRVDPDVERSRVIPVIRALSEEGIATSIDTMRASVAAAAAEAGVKLINDVSGGLADR
AMYSVMADTQLPVCLMHWKTVRFGDAAGSADHGGDVVADVHQTLDKLVTSALNAGVKEDN
ITIDPGLGFAKTQEDNWALLRALPEFIAGPYPVLVGASRKRFLMAVRAARGLQSGPVDAD
PATAAVTAIAAHMGAWCVRVHEVAVSRDAVDVAALWNA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgaaaaacctcatcattcccgagcgaacagccgtcatgggcattgtgaatgtc
accgaagattcattttccgacggtggccgctggctcgacattgatgccgcaatcgaccac
gcccgcgacctcgtcgcagcaggcgcagacatcatcgacgtcggcggcgaatccacccgc
ccaggtgccacccgcgtcgaccccgacgtggaacgcagccgcgtgatccccgtcatccgg
gcgctgtccgaagaaggcatcgccacctccatcgacaccatgcgcgccagcgttgccgcc
gcagcagccgaagccggcgtaaaactcatcaacgatgtttccggtgggctcgccgaccgc
gccatgtattccgtcatggccgacacccaactaccggtctgcctcatgcactggaagacc
gttcgcttcggggacgcagcaggaagcgccgaccacggcggcgacgttgtagcagacgta
caccagaccctagataagttggtcacctctgcactcaacgccggtgtcaaagaagacaac
atcaccatcgaccccggtctcggctttgccaaaacacaagaagataactgggcactctta
cgcgccctaccggaatttatcgcaggcccataccccgtgctcgtaggagcatcacgcaaa
cgcttcctgatggcagtccgcgccgcccgaggcctgcaatcagggccagtcgacgccgac
cccgccacggcagcggtgacagcgatcgccgcacacatgggagcatggtgcgtgcgcgtg
cacgaagtagcagtttcccgagacgcagtcgacgttgcggccctgtggaatgcgtga

DBGET integrated database retrieval system