KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_2008Help
Entry
CDCE8392_2008     CDS       T01700                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CDCE8392_2008 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDCE8392_2008 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CDCE8392_2008 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CDCE8392_2008 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CDCE8392_2008 (adhA)
   00626 Naphthalene degradation
    CDCE8392_2008 (adhA)
Enzymes [BR:cdd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CDCE8392_2008 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2116720..2117760)
Genome map
AA seq 346 aa AA seqDB search
MSATEFPSAFTAAVVDKFGSELNIHDVDLPEPGQHQALVKVLTSGICHTDLHAAEGDWPV
KPKPPFVPGHEGVGEVVKLGPGEHSVALGDMVGNVWLWSACGECEYCRTGWETMCEKAEY
GGYTVDGSFGQYMLVDTRYCARIPDGCDLLEVAPILCAGVTVYKGLKVTETRPGQFVVIS
GVGGLGHIAVQYAVAMGMRVIAVDIADDKLELAKKHGAEFVVNAREEDPAEAIVKYTKGG
AHGVLVTAVHPQAFGQAIGMARKNGTIVFNGLPPGEFPAPIFDIVFKGLTIRGSLVGTRQ
DLEEALDFYARGMIKPTVTECKLDDVNSVFADMKQGKIDGRMAIRY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactgaattcccctctgccttcaccgccgctgttgtggacaagtttggctcc
gagctcaacatccacgacgttgaccttccagagccaggccaacaccaagcactggtcaag
gtgctcacctccggcatctgccacactgacctccacgccgccgaaggcgactggccagtc
aagccaaagccaccattcgtcccaggccacgagggcgtaggcgaagtggtcaaacttggc
ccaggtgagcatagcgttgcgctgggtgacatggtcggtaacgtctggctgtggtcagct
tgtggcgagtgtgaatactgccgcaccggctgggagactatgtgtgagaaagccgagtac
ggtggatacaccgtcgatggctctttcggtcagtatatgctggtagatactcgctactgt
gcccgcatcccagacggctgtgacctgctggaagtcgccccaattttgtgcgctggcgtg
accgtgtacaaaggactcaaggttaccgaaacccgcccaggccagttcgtggtcatctct
ggcgtgggtggtctgggccatatcgccgtccagtacgccgtggctatgggcatgcgcgtt
atcgccgtggatattgcggacgacaagctcgaactggctaaaaagcatggcgctgagttt
gtggtcaatgctcgtgaagaagacccagctgaggcaattgtgaagtacaccaagggtggc
gcacacggcgtgctggtcaccgcggtgcaccctcaggccttcggtcaggcaattggcatg
gctcgtaagaacggaaccattgtgttcaatggtcttcctccaggagagttcccagcaccg
attttcgacatcgtgttcaagggcctgaccatccgcggctccctcgtgggaacgcgccaa
gacctcgaagaggctttggacttctacgctcgcggcatgatcaagccaacggttactgaa
tgcaagcttgacgacgtcaactcggtctttgctgatatgaagcaaggcaagatcgacgga
cgcatggctatccgctactag

DBGET integrated database retrieval system