KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_2030Help
Entry
CDCE8392_2030     CDS       T01700                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDCE8392_2030 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    CDCE8392_2030 (fadA)
   00640 Propanoate metabolism
    CDCE8392_2030 (fadA)
   00650 Butanoate metabolism
    CDCE8392_2030 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    CDCE8392_2030 (fadA)
   00072 Synthesis and degradation of ketone bodies
    CDCE8392_2030 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDCE8392_2030 (fadA)
   00310 Lysine degradation
    CDCE8392_2030 (fadA)
   00380 Tryptophan metabolism
    CDCE8392_2030 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDCE8392_2030 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDCE8392_2030 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CDCE8392_2030 (fadA)
Enzymes [BR:cdd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDCE8392_2030 (fadA)
Exosome [BR:cdd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDCE8392_2030 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2150516..2151424)
Genome map
AA seq 302 aa AA seqDB search
MMGEQGSFDAVALKKYPQLETINHVHHAGNSSGIVDGAALTLIGSEKAGADMGLIPRARI
VATAVNGVEPAVREALAKANLTVDDIDVWEFNEAFAAVVKHAQQNLGIDYEKLNIKGGAM
AMGHPLGATGAMITGAAIDELHRISGRYGLISLCVAGGESGITGIIITPAKKTFFAGGDI
KQMSKATEADAEAMFTMVEHMKESLRLEKLPVPIVAAINGAALGGGFEVALAANHRIAAD
ACGSKIGLPEVTLALLPGGGGVSRVVRMIGIQNALMQVILTGAQMNPQPPSGTTPHVAGP
PH
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtgagcagggcagcttcgacgctgttgcactgaagaaatacccacagcttgag
accatcaaccacgtccaccacgccggtaattcttccggcattgtcgacggcgctgccctg
actctcatcggttccgagaaggcaggcgcggatatgggactgatcccacgcgcacgcatc
gtcgccaccgccgtcaacggtgtcgagccagctgttcgcgaagcactcgcgaaagcaaac
ctgactgtcgatgacattgatgtctgggagtttaacgaggctttcgcagccgtcgtgaag
catgcacagcagaacctgggcattgactacgaaaagctcaacatcaaaggtggcgctatg
gcaatgggccacccactgggtgcgaccggcgcgatgatcaccggcgctgctatcgacgaa
ctgcaccgcatcagcggacgctacggccttatctcgctgtgcgtcgctggcggggaatcc
ggtatcacgggcattatcatcacccccgcgaaaaagaccttcttcgcaggtggcgacatc
aagcagatgtccaaggccaccgaggccgacgcggaagccatgttcaccatggttgagcat
atgaaggagtccctccgcttggagaaactaccggttccaatcgtggcagccatcaacggt
gcagctctcggcggcggtttcgaggtcgctctcgcagctaaccaccgcattgccgccgat
gcctgcggctccaagatcggcctgccagaggtcaccctcgcccttttgccaggcggcggc
ggtgtctcccgcgtcgttcgcatgattggtattcagaatgcactgatgcaggtcatcctc
accggcgcacagatgaatccgcagccgccaagtggcacgacgccgcacgtggccgggccg
ccgcactag

DBGET integrated database retrieval system