KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_2072Help
Entry
CDCE8392_2072     CDS       T01700                                 

Definition
putative secreted glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CDCE8392_2072
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CDCE8392_2072
Enzymes [BR:cdd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CDCE8392_2072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2205898..2207052)
Genome map
AA seq 384 aa AA seqDB search
MDNLRRVFTPVSLILGTVVAASMLSSCSQDSSQQAAPSTPSSTPTALQSEQPSSATSSTP
QAVALDPVQLRKDAASLMMVGVGNFDDALFAIQQGAGGFFIGSGSDPQILTTPGRDIAEL
RRIAGRPLSVAIDFEGGRVLRHRGILGDFPSPQVMAQTMTPEQVRGMAYDMGRSLFAHGI
NVNFAPVVDIEAGLEVVGDRAFSPDPLIDATYATAFAQGMADAGVRPVLKHFPGHGRASG
DSHTAQVHTPPLAELEKLDLIPYGRVPVAGAGVMVGHMIVPGLGAPETPSTINPAAYQLL
RSGSYPGGQPFSGVIYTDDLTMGAVTSLMPTVQAVPAALAAGADQALWVSTAGLVEAIDA
TVAAVSEGRYPVEQFKASVARVAG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggataacctacgccgcgttttcacacccgtctcgctgattcttggcaccgttgttgcc
gctagcatgctgagctcctgctcgcaggactcctcgcaacaggctgcgccaagcactcct
tcatcaactcctactgcgttgcagtctgagcagccctcgtcggcaacgtcgtcaacgccg
caggctgttgctttagacccagtgcagctgcgcaaagatgctgccagcttgatgatggtg
ggcgtgggcaatttcgacgatgccctctttgccatccagcaaggtgccggcggatttttt
atcggctcgggatcggacccccagatcttgacaaccccaggccgcgacattgcggagctg
cgtcgaatagcaggtcgaccgctgtctgtagccatcgactttgagggtgggcgcgtgttg
cgtcaccgcgggatccttggcgatttcccatctccgcaggtgatggcgcaaaccatgacc
ccagagcaggtgcgcggaatggcttatgacatgggtcgttccttgttcgcacatggcatt
aatgtgaactttgcgccggtggtcgatattgaagccggccttgaagtagtaggcgatcgc
gcgtttagcccagatccgcttatcgacgccacctacgccaccgcattcgcccaaggcatg
gcggatgctggggtgcgtcccgtactcaagcacttcccagggcatggccgcgccagcggt
gactcgcacaccgcacaagtacacaccccaccattggctgagctagaaaagctcgatctg
atcccttatggccgagtgccggttgctggtgcgggcgtgatggttgggcacatgatcgtg
ccaggtttgggtgcgccagaaaccccatcgacgattaaccctgccgcatatcagttgctt
cgttccggttcgtatcccggtggtcaaccttttagtggcgtgatttacaccgatgatttg
accatgggtgcggttacatcattaatgcccaccgtgcaggcggtaccagcagctctagca
gcgggtgctgatcaggcactgtgggtaagtacagcgggcctggtcgaagccattgatgcc
actgtggctgcagtctcggaggggcgttaccccgtcgaacagttcaaggcttcagttgcg
cgagtcgcaggctaa

DBGET integrated database retrieval system